IRC-Galleria

kanelini

kanelini

Sd.Kfz.250 ENGINE w/MECHANICS

Uusimmat blogimerkinnфt

Blogi

« Uudemmat - Vanhemmat »

[Ei aihetta]Sunnuntai 04.06.2006 18:43

8;Ued?t!MPA7QBtEcgm]nBh`fbY9\?%Ed!kbQA0@rfCae+iF(BQKa/Eo++EY+7_O' ^MSG_rMoZ>`[\HJnUGaAK]HSA^7>6#)SrO?6A-1X)&YGH/R>d7^q`dm^qe_c^S%k\ 1HhL$5pKN2_9gWI<!Pg[K1S]IBka6uR$+)+WXrE<>`tO[XPfM5S6o6W?^+ZUR\H^Q i0]_'&-Ob^=<T*#345[n-jk-s6>!JhU-_FK@S1BQ@SsR#I[YjaAmTpXAO3>JUUrj% ?Aa2\O[:Bk?ZBdXEFqgT@Sp`P0iTgYQXD/GYCSs#6(!4kOc^qtdJ#i=+!%a^IgRc= >l=HqN7Z;2qgQ\EIM_8Ih=#71q7GataD[3dmnJ#OpO;T2/gA&pjgS%Fn+,@@[user]^Nm[/user]<f 0)=r,h.Q'JP4-'@[user]\IuZDs7VQ[Raliba[/user].fVnhk*&BrfR4d<jZ`GX%u>V8"0)=B"%.d hd'?nn%/PcX42>/_t+)P]$\:#F6+1EYo[/[o(k0,mp&NX,9.=):%[Lr]DW4MXoBQ` c<!+!Vq0)LAQ->[GI)^i2>L$B%t!]f+(8*_a3E]?S_*J.Gk-'0DU.?KpUL;+$ilm'aP[~> m^_N;HiEJ]kM-Ff!*J/>&>8@JSp5*JHcK.e="/DVLW0QHWfO9.*PbEK9Faeb#Z_?< ISUVWc4!L-N5'Y?s6I&c'$W@qN(jc]qqO%05^*i+D]%:e\FJQ?FZt\lK@U^2j=p:C l=p8<btCRIG<GiR'n8">'*3chYq8=qTWRN*5Vk6(4$NH3"MV`Fke)ZD#<*0RD`W'Z Hj[ZoSmo>mZ"<eB_G*7TUq/apD::nnY<Np0cjnG!9(jHUMfmrlp+p-H:lQFIP<pe$ U6Qh+,qKGqm#QBZ328;c!O!qTjWDXHik_,,:S:af;,/P^BBSdnI)%uRj.jc?8fM)f ZZlfJiB=#=R=^L*ItAk&$W.HY%`_up`kV[pTcIa<$[0@+7/.LG&N8Zbn.)SgKML/) bMgJQJI?E(?@[user]sn^[/user]%U?4W.KIn#X[Z\p3S>0101=O2K;60MkWio`jh:K,1`3m$>]+M. 2iWXuF`ot)i&Hc(eQGn/kM%A:X6=*ki+VV"ojG;g4H$-W2Dt,-!S(@[user]56`[/user]<:0U@`$g FcWMn#C_->Y!Agu@/5Di/@8e8`!KWTNrihOi*[oT"P9=f$Qr1'`Zq]S8AeMCD`bNZ ]3/6i1$&p^":EN_"h5Qm32OjX'JOnI,'XI-3'uY&Y`N^urN3(rN884gFi<)I&:R,h :+Dmp?*LUoEP3BoFO#aa1nT>.quN@:(X0AsN-L`flUgMr#u?/0h1fCi:&AfqJ.9rJ B\tYgN4Q/sB1'gar.X\Xr2K69Ne<)WBMgM5-jlT^'qD3"kM\+t"Zso&\0o'^@[user]fcQH[/user] r9uV`fW4q6cC*Sn<WBS7%j*"mS)h=Rhq189L[R/X)kEt$q/2'e6p,ic\VlM!\#JEM E1AVXQ)iP3lgq?@[user]jKBiBo_kgQD\[/user]=pGSoZM3Nh8$(?Qk@X^AEWE4/(HPakS)Krt-!t rGmSVH4ZMnAe8U>4#FEFNE-_,.a3K98AL[aI%,Mi,_q3)$gb<b<GP.<hI91SKGr', Fa()$^dd2^ih;7h2"Nk+.@[user]1[/user]?bR)DERIuSN`QoF+VKV2:hT(4!gXTK%u.nMhq?E;e0 4GM!#eIYJ+I;B#A_c[8/po-bWfL8,PYYKEX5,@&2Zbf/2Jbfi$Bl4nnkTb=R\O/,J nh8ia,e=RAhW$aH.]9p<k$`bB:C_=R<^VDW]l[U,)NUkEdT0M:,`bHgGKTAmKDh-5 R@\46D=q1&as;.mENS2'bI*@[user]G]qB[/user]*B[uFX^4K?]eg<<VMgi)<.`]YNTmG)l(gZ_eI MgO5aH[,`9fD43#_!OIkMtm8O[u7d,E_hM[/E*0S[nF7r_X0,HO)e#VpJc+X&oPb" Y2l0(^8IFc3;5)fFq%f\<A>.Kp]&XU#PCf#hk7GM!'N09$hP>TFBTQi)G+=_SV6X> BE[f9V3CFq+/G(!,fZ%9UadL!P4Vh^oR[+N1!(KB7nG2`f#l32FsU'_<osC1UQE'i K0;SMi.J&:;j9ut=g1HTP]S5`]Vs#m:166ucVRRq6S\O#D%'^]E(O3'>b@*m4aOXi >bZ;O4Ap$JFe!nmgX1SDM=!g6p5BLKH$RjPHa*=]jgXt*hpD&06dMAbpY<+<cI".I 5[>(5cdEh\-s^XC=H%ESacr#t#E)H`=sT)81"/;s)F'R^GXK-+X:[\XBdV6q=9d:Y b@/o?6K'uIY1)_/d3br]m">X3fjTe@?>PKXqAl8)O]@[user]jP[/user],sHBaW[r4l`D?"EKVP/Y "Q>Jb1ft_GP//DjMBp\EIYZ`OFP'D&D8cN)8H8!T4LTT]('td5hIN-5B.+):.\)Sp )lpbB4oNq`n=pNK-$Oqsk&q>+WD:>0m#S`YRnLnnl;R#q@OWmg/PC:&<Qoi**_Q17 pGA^I5LJ2:]$WQgTY"cH6g*@[user]Q[/user]&R8mB\VXg42cN.?3pJIce7k0-V-uA^/2)Q:=_F"Q 6E)G<(7$/@AJ*9(ULCEj$PXq/oh8qAV\!==k,@;ED9Nk_[p%X%]in5B?6A9cjAOCk gr-P2$$dl4?.JbAXgQ]6'sYgQFZ2612;6=NhR'J^[\Bdp_J5(3-sbPYLMcA*,B#P) ^*=Rp>sV,T2UC<%'fNuCSl"%J;LtR.RPiTUN09[)=u_B'Xm(-^fL<9i/_NP>k*AGs b:.sX[0W&[4G.Io1RX4,_<nN6B$';a#_E=/UBdpq<QCT)_GI!Yp.?gV*LR_EXm^') UO=5_GED"T[;'1`.u)k4Y=DKsWsdOQ=)SW("e>-a7ZE^F5@=:BHEFpFHe7*5RM?U9 .%[a',srsT$Hh%/;J/C^H0f-E+WibnV'[G.Y'e"NE>q;KTJ"[SK>aP^I6OjSkXF*U -/k#<<$oSD"]tp\.S#M3?+@$DF8Y@ke3*/<I<f>Eb"'`p*n]A;LcC=YmT;]kSY<nj =-%de,ec"=I&54?@[user]n[/user]$E(of_inbC>nhF[,qmV>[.50,pE:'4i,-UqB#cCBK2*o,bF3 .Vid+07YLs,;=roQJCSGQfu)?=.c_)[.^X?SU@q_p^;L?[ncBcoaIX_GP>NnrE*.i $SRJ[S33&9C4G]p2;@[user]tr][/user]/G;a)6%>YM`>LI=2=()MmCZET^%CIBI&eZ0"IK)?<?=Q DI'DrPPi-<-d,*M&m]t3Z9Bi2NX\i?"1SDJ'0+fLPDJuP2.q&WO]YuaDkbFG5:;]% WRkK:puR818s#Og7b&fmm(ee)>enbu=RP_]6YlfX`5I6"X$3J(:gr:E@,R/'&_8^G @[user]o[/user]+nB@-97V:cIOd2.i.4(/m%*&8#;`LR2&'&;3;VXP/2^##JG+6pS4"!"1;HBKcNQ Um\c^3f&A%%FAbm"fjU),<To_AR4qDJpl+]!hFujip?"u@q;Eg/CZ5PeD6Z/>T<hJ (ul#fS_UNn,92<2ZmFg.oY!S.K1oeb<@[user]e2F[/user]<4'k4\@[user]l1]F[/user]$^nl,!bCD&*c5R@*@[user]-[/user]; 5upO<6.1EZhLpSia@&kKR$YXV=2pVuMa:10OWDD2!jH]t5nB,0Ph7.q%e0h3E)SYP 1,fk9WYZM9o]4L2I8UFM_fNI7-YD%W#c5%5q8>;I"u1k#MFaT=7Q,?'oTf)A\-4WC HY!FBG\)ZGg?9tb`".AI/cupj1-c7_ASkma?jQhmB>?]1'<n*j!:%Uai__gc0ei>X K(G65Y`o6q(o;bMNIbU_/0ZPj/g2Yi/OR,+5m^X11r(@[user]E3[/user].*:Wrs+\ks8W+K$k4jd X[!/20Vh!71Gd*-0L4;B5di5.bm%]]JO5r^'.BTq&.W7Rb@H?..%;*Q@PX1m!b@pW ZIp(r(tkH"h)tW6[6sO@b>O7U1J94rMt.KR;KW(^&i9.#QXk&EE!1>R4;e!I:n&Vm +cde1To:.[TnoBZa=:Vs"H!ur72(7=</)M<:1ktda8tji8CX]`&-1:JaZul.eBnS_ M(9!UJ:/pZ?in?:"0e-8!:7N_"6DdniX=cL#$(p<+:[c-_Is,u7SkTM%a_!.*XI:. )),/J^L6iUOM\Yf8Ih0rJ9XiMn!ikF2ID#lirr!Ho#`'+@.aJtIh15LR9+r<%Q&qB ";h.=lb;l~> endstream endobj 43 0 obj << /Subtype /CIDFontType0C /Filter [ /ASCII85Decode /FlateDecode ] /Length 29456 >> stream 8;S%DGuU$k'uo->^?,=Mn!dbWK4+sr&-c`s@@%uHL.,KP7M,cf*J-qKRN+U^9XRkd WPi)L0i`%*Cc,'EDJ9[$Y\>;5]*4s!1f^V]hB=Q%:@:?m3VPZ1hXfOoP5r`080eh9 0d.i#gZV]m1HRSW[t^eLAT;Q&eA^LqYA;.uB\2NrK#`;onT+Ns6G^ifBq(b!2A-=\ k:U%B=]=jqWTKtUZ=%&l$/bdb1*?h1^^f!!#N,lb!"h0kB:o5W5RCCt.e!G05RY5U %ep)-n-8t:&;5UR&-W\s&L;rRO90$G1lr2&5UOPRft\#.JK-?KjFTLU%gkT/=9+Y< cQuL8SQ$RdK8QRc<'$:9RAien!O[ki7BN9_5cpqB;4FOsC+$EYg-`8GT2We/P>jVd Om8WhTWV-Ze8=I\ol'+-c-p6G-,#CH6uSc'ksP(TqA)4f5GlKb#mN(GULuo\(ablC c]g.ib[oouVO&04rl_r``gKE\J'<8jNn(J0C^`CX9jtB\6FN1c`AXr9fN*/;H^[+@ ?=^\#bA7^D`t#>+lju8$5%Vdf8LT-JOFeHoL'm,GUL>_/!k6$PE%a<S:Vs<o2m<C- _HZL^HiOJCJ<QKBkK/!hhOKVTF2"/q9B$l#->j'tS,3S;J31u'aW9QiE#6#*Y*\J; Y&Hb`D/P#R^cgl#\@[user]3GD[/user];M5UBA4VaIObfNi!bmbtq4dp(L*BG>MFL/c%Ab9_b!9Pq $g"%l-m+_L9!eZ%6k/>nZkdLIXm"*p3')oATke<A%AFg*2BTkmn6p\Y+2c.i)13bq S'U':p]^R.IKdKL5Kch.]H@LRJg`SbmQuR<-^4n5_?s_BYZ'1-ZjDMA52hMU/;siF KL`lm@8qJ#]FnPoBGm$@[user]1-[/user]:mP;ok1Y2jm.t,n$#mapM[uBt'm=kcE^]87JYS!ujLX ?n3:X?jAXk:4RO$7nL8PMWD0>Wm)u^;<]'7L\)qD9td5poQL'Zh*hi./E=Yo0ZD6k Aj:?p\]\TjgXp:<#u.W6rX#0N?(=%obLL[#\1ofFD6V$/`/E2[7Jq'&8,e3-$1U?W 0HftOm?Bbrlf9qo%U5p7g%K?-Y'/?=qs<b(X6_dthfhV339h@L\D$JOj0L3!;g(pH .QWG6Yur&gJkfpUF&)1oj.3Y@5?A[9onpL7hRhuWl<V,EH)4cI4K<e4E`]A>Ff?Fm .UACOSoKt+<P!=RAa4R+Y;JiaWi=S9dsUU:EK>0Jj*kKQp!c0d&<A+Yf0$:8_6_S] TP'VS47.(U?aYs.4M@&*?2'*1RGM/]n*%-i(>Up\GPWH\2Z4s#Ued4NRElqH(VXM= o6q!p]DUM'ndJh'-N>=iP6&W'UOggDHNM6?Ad07dNXXbU4<+tOnl[@[user]Hh[/user]&JI2D;)?1 @=20W=D)kNpoa*6&P3Q>,2Pg*7p_2_MRjXALgD*M1F=uV.s>q!cuf<P?#`VZ2/u]1 (hU.pX5_kH?p\#5-)668M6Ska26f&Z36<O^H.'ZBQfOUrhNWbZ>;P;PhFW]%4d^uP 5"ShOY>2iHqC#ig`qg+6\NS,t[3fZ74#d&"=_BoX9/inqG1c013MAIrjqQ.PRN%If 0X![d13`!<#PeDr+6WA6p_>>5pqG+K0Y24IiP,`?k2jhQR'2q8=JRDr-ot2K(KV=F Q%YC/Pm3Rm/b:AP;_B_1?2g^1?H)/$IHB.^kc/tOm&ILpra#3dK'WZs$g5Wg=\^$r FqQ5"ig=bfa(co$[q"68*37@rZ3,4pJ5dpg`Cgij*N59fa7q@f<l>_6*0<%Xc=<H0 fTS]ne4QI<+F7B-UV=P9N5!42\3_X:OQ'_FnID7ip9SNm0E,LIH>URJ\qZ3"(F_Q& p<Q*QgYgpU>>?2?b3LSlGe_lqES8;02H3'a`F"GNSX#C-QF-0#0p*Wg-S^%?Omg67 a&>B8$maf-QILnWE,<J4V`5[JiS"8O:5kVu$Hr='RUhLRP?$[38B5J8M)2;:7F9+I %IQ*2j6L<`:$&c_20Ek@o`seT<G$'7k[`f>6YW9kTmK,Hm-8HVml?Bh,Ds<tHP]m? %l%f*I80W>,VYZP_DH$4R"rrDhSqIR[lp^aNLE=H@?J*RfM>EWX]N2E@fVa[=pD3h psAqknX00srgo-)-'gB'T+VAD;>UM0[)KW:qY;)_k#l%l>a)`J[Aqka$eKi0gAIWo Sc,:2o,j$.3e'AU]4j;78kdeKLTF"`c"cQ/'UpfG^cj5aGkEk9C=ZK?]c7`u$#_hh aHBmXg?@[user]dg[/user]&?kEPMbWIPaXIFdZ6[k!=$I025K.&a)^UXffe"X'9<.uBlP938B"DnI _raZAYAQCCikkN=N@mFShMb]8(oZ7uMBY<^c+)B??=RN%V"L\sCK9"&$U<U+:Gq]3 Q4Y)\[U?QEbRikGT<1[rjeenbbr6+C_SInZ^O)jSc_[GU4dmOkiH<3p7+juTVV%,2 !fIB=9QH3h5pH8J3!qaGYib<lm+%gR>B$2/H8(XUM)6qfl]li69<iTsmOO:Ph=?im Km7a7a^g69(Dl=-?l!`Q-JgVuI7#L^M7J-6s(#/E<)c@'<p7#[ObXE1_!^9k6Akt8 0M##NCYFfs#_G^2AJB\D.ZQ5MZY1P?M?:(Uf[NG+7ZE:F!sQXY"Z:l_&M](c?p"MX 136fL+*6R%->2J23VB04h06V<<O]^=DLq1lOE/sgZl_IpH(JV+niF!_]B6T&:2r4R ?+SiA"c8ra-_b(U"%nfEr,8b"<3,.35F8)nco0f)2Hg?_S:Vj!H3Z&f,G]s0[C"H7 !t@^YrOb.4_[%#O>1?<mhC:?J;cWG<mcGiM2<<a$T?2]T8sb;m7YYr!CK.+P;t6%f 8:kYns,Q611\DV9pUJ8BB]Zg]7?0.8^rEf7E[COpeVf8,h#ea1Zo;"e>m[:S+Csji >-25\=RDuinSSR<86R)"hDDd<0ujPVXPlP"f/R4P"XA[<+%?ZDIQs=RYd&+04/ZDm ^4ffU9%G0!G+)?k\"D-\ca$B1TftKM-=B)DdE$5ICjWH&'Ns6.j)/!p?%k]+Ur,s( I]#LcdEt165O+J6B>3f\EECkch0j[DqZdt1r-WL4<.eiBie-i#Q"tf3^5<8X9[kCZ Dq4:S3e,oC]TZ-b_,=!FdVLoVI3LY#]RRcq\:>]u-JgO)1hBg-k`KgFo].Y37q>V6 [3]tInmb>,q.\%.fU@4'qbQ[aWBAXL[VJP1[ON3M>hMfC.(d:aol80irHlhQK'8Yn HT=%-DH<:-3*fH`o5.c28U/6iRX(XZW`cFTCC(di)ht^f)qbCg"@%q5_GC;nTnLB; &mY5="B2FHKX#>7N,l",^@[user]1WRfC[/user]+4@:Nn1525.S)!%$T-)?I:X?X\&J*4,I#lp14f [5uOh7ZQ@l505kliN,D8J%u1)mY(29Rsane9BY,O"sj+g]f1i]3"DK5!L$n2IKgAq e-?Wl&'<Wu[lCc9MC?Ne?jV`6E)>m@?t/.QmmHY9A@M82:uDs(;kQ'LZOK5,SE2mQ "A^H,"7HLa6X#@=d#[+-U.FDUBq(fO\%Eqf6CFd=<oB`boidWskI,i)R#-%">L0W7 @+5^^`]K>STaYdX.[m&ak,hVfpb&SJoLdB1)pg"[Q:rS(`\==&hISYPXOC5f,!&Vh 4_09"H7Qj0"HaRL+2eJ66k9TDHljO(;9V,8kD-TB-t.keKQ%_*oF/i'%5A!LW2G@d gu/XO6`r"e=,L_=:D/A5cW(95.E/saBS?dfcPqo%kq1sopot;Thue%-M_tI$@[user]h[/user].]C `Q]C^9o'3+!$RnS-IX[RYG?.T"'5b@&diUa%gs`&1K'J;7aWdg)q3o-TOCmk/S[1l e(H3"<)GnS\;+SA6G,a#PfL1p9fj;o?cuhF9u*L-i8dnmjn"[AdkqFQYm\:i\)09L -ObrT?=Z:'rOIelPI!/3OkU!H=j:J171/4g@t+7!4/l:2::D3&QM3;@.fW=gg%PZ( 1m>%#Jm]@!D8?@[user]QbaKKIM[/user];[<^C+-g,PO^lc)"j@,lioo#S1/Y<7l0g;Pb@O_]jLjV NBO#E8Xf"nN+53MQ6+VBe0G/JFdA_`f*g!B]^5k>rU[mri'M\oq.-gq%]s:*@[user]Z[/user]+aC "^M=O/@`L68'cMmbF&fe&'SNlGnuj_7YM8A-@[user]KiZLLX^QfJGd[/user]/0:1!1K9APflt)3; SRB$5c5YB?_FQEeN#oD9UsXf8hDd8h/<YW^b1j7Fme<\*l2-Bs\`/d%lme.J/Ypt9 -H9tiDi3?c[mK@?2rMC]hos,>U;m2,B&VXsn%O3@jD\-[Ra;ec1`S@u!1m!tg,]JN Y6I_[Y\0?/$hu?_bN3fFIE70).oen^`C(PFLrZ.n&g2e1-h.=O&:D94JCW0KP"0`F V3$QNM*EF20E)U;)QU&?Zb1tV=l*qb_]b;Y6lH#Ir8k/(I[SJa9E2F]N,DN"a.)$J p#Pt_a*Y>AbjpH_;B.AmSmT5qCag=3r80-.F*ti*/>ZR+nK$,_D86$n'8BbIYV=NA 9FWGZ78o`PkAe!?JCnk5k/_jC23]fV943<frS:;gg?as`Qn4@O,2@#jN(1E^?UX]Z Eh05(29ermC!PT88n?,0!VcrUj]DX)=cja8,(D2oNrMJ94tm`_.[M7#40Yhdm.0O8 dIQe:R.VCCl'K:<5!ek5W3&;+m6=d>F[X5Cj%CJu\SZd1_2!UQX)aL@72@F6R!"[s c+6a!-.ACq=ILRT-!N1gkg2eR;Pf/h/pXJkNQ?E_F]-\Kg:3(2kLQO^U]$C)ep5H9 .k;_1Q@"acF\%'j"pa0DSi5apV[^jQUh<dE\r,RaIuu8T`9u)pg>X1fJ!/Wd,<)`# .h_)FS5F<+$3T[<mM$>Pf89fX>_O3J9U1t3DU)rti739*oW%CDKk#I0\lX*UC+D9k 'qFooq3A%E6jpg9c$:C?2MpRG%)#3!/K?.l8MK=5_-Cq**g)DM^F'(F8CRqEkem92 *[GP5N^c)D)n%*4`Q05)NfqEmVAGTBbDLct0<CfafV@ouQ)kLa3+M2(lWf\@%>-[> -q7p54jkc=R_DGWF]=9CEgn\X!TsNn)('8;$UuS(U)CZ`dTFKC2^J!di]Yprr/7KJ "LTbr#t;S$Z-G_s]cm+(?"kB9&"&\;$9n7qCc5W3_bf+ED84kOTUTQcV1pq;"9'%Z cp;J[38BF!B#AO#d1-ZA?#s7%R]$+>nS4&@[user]i_6[/user](!O.M@[]$ZQIi!pS8h8i5$'\#)u Jf7&<0q^uJ:m"b%iut(B<1Esn0KMdQ0Y"ugR,\iJ;,</>ooZa7,G67)B^hN<5!bp! X0K7<T&$Li&G%^@[user]q[/user]p@Y)gfn.A\m8<qamtWRDB0bn[>r7b%+D32`I5*p93:G5X.6fk "0jK)a]Z>/BA]CMqt;$oZnH(&b$DM*%V3QBZ33P8U*:Sf1"/V;8NN]\J+@/De)T"\ LV[hsNQ6P#EFS]9-4KtT=S.qheZYMYm]R:W)2rsR;BpR#`F=(QP<<5&.mP^%?%SjL _aZ9gcWtd%C"r<ZVS2g$m@)<PB6ihhWi>^\R0F)JYrVpMC5l[^.mhk@kSZ^VB&KW, lC<._Pg/+`kNmi`T3H*cc.@[user]8L[/user]=7I-&C%e)e*+HnIi6@7CXu!Ztm'5PJi='Fl/>P)o _?>j[D8j8?(G2\2?RFH7M,;SK<Ep<n0h\MT&rq!7/K1!?=Q^V9NVt2OYUjg;juI"j cE76[)kU8KmZm2&Z(m<rPA$4J:L'q4p04d-4?:Ls1mF_-$?Di(Z!YSnV,;O&(R.Y+ 3i\e(]'n-jCcUm5MBCSCYQ/do@Kr^gJ<oWd0Ydm,O9'7a&ZSEl=NgRhcj.741UPV; V1U]8K751dW;:Ojf*GNm3B52B+G`@[user]2U9l^UW[/user](<4(*%;j=otMXR@?'J=lLrQ?J18u1 r23#>,pf'\epmSHf'pQ)^$B5Ie[NuDM(@[user]q^R9[/user]%DI+]>+:][DCKjKfXS7*nWh.E$FB iHrD'kS,#!2.blS.aO^3P>n+qCHJt3kOG79Z#l20H4b9811@SUX0t6&FsZL[@@#9] \VneL8FPa7]J$^6GVk_NFA5&f0p@GQ,Wdb?o=XY6Y4e;Z>M#G27pAR,qo"t55K0F" cm69`e6'^57EWC[KtF#XD2AQhm+H3T&<;36i!4,D*$j1KR.dpDjX0s./*K_L4a1qa Qo^%Sd<)eM=Csgr\]BImq2Z!/NlW@chqZb2W4fb-G"kK[3?Hr>B(L=sI&Tk_F-,d% RP*)q+g-82F+q.'@[user]-[/user],,-Mp+AP/6LXUeQs"tP6G`SKZb?a:DPJe9u>eA:A(.hZoi)G ``_ErYFZe_d+EX8@%4]qa*Vq=edMoV4sjLtbBCp>$Ud?IT6bS*3J;bs*;l_5h":3D %hEj)l90Nih?o#K?+$%oa&Vi,WsuB!\<7@MP7L0R5X-5#5X+O0LCrJ=>dg>&8E(Pm s!JYV7d'%8g?<O^\..?p9]FWIJ,N:5$5FiS$!CNCK)QPTLNjeB#=DoCBfu!h`f21g 8tu_@'Md`hMTSqM-8,g@\cgPf5cKp8aa#u79(lVY3bX5EgXme4&>iHdA#26Hm%STN ?,5/.PF%^o*JFg^q^Uh_+oX)?&AeKE+mg&B$0`E>OQJ>V/=*@[user]QdC0qlfqQ[/user]?gKld$3 A+F7m6InK9q<f4"dU%=h/^,MgKJ\G:a2;5oP<:/h*BARh;0$Y'^F!o*U*KXL#WK6+ _,'=7canh:#X8Z7Y`\.P`KbNL[615a`thb`T>2RdJ-mBN/&MqU7F>%@/YX"D)OugH haFC&382DY5]HeY(h8LQqM<`6?Q3nRdW23p@/BGJ8d_:h$,81Y?1<\<+).2!Fu/M? bRfHffAco#pr+SDO%!K'B^/X7&K;cg[)9pGrc[&43e_EA/4hFbcg)tAa#ann#X7"7 W2'E&D8>NI4n*O#n4t!P#p((P?lmdX_Q\0mgH4kV*aWeAh,-J<NBXgPLtc6-.gJ%, =X<X3V.19,id0UKc7Ff(R`cWslK:-[Y(j`/:OD*Nj$e\20<.H*)kI8R@52Au2)Ls) =GSK?QNd@L:o4[X't5<dU>g_7pe-g<]g$=M_.;NQgHZ.)B(:S3q9b3f<T%6Xpe=(e 3?b/$3+KkPHP0Mu%,n-hKDFA<+hs&D^kN42%C!-Ya$UqFif>W-h:4KWqXe1]j%^G- V*;Qm#&45$n"TnhcHqYOU2/IQET"3c>.#_;S[Qmi]d:7p%Dg%%qCm@]3p!'P;7h>! cM$Pn8Ypj&_qB<Sc&1,Oo[dpOGY*NV%A,@[user]hP[/user]/PiOPC@E^LN;.q=-LCknPYiF*60YW pG[Ju.Z@Z6.K,Kd#nFan-A>kjSAj<!=@,K46P(n"/YXUoI]Nm2R+loN-]8hXPpR4l (*r0Xl4]'HGR,NQD\31.K,TC736W?)WF;r=49kF-EmJi/<IX)rk?G+Yda1$`)-8lR QsQ:tbU?dqnnI.HRq7Aao&,K,US@KQ]`n&FC)aXoVmUHId8D:"FqKKc18g+!@[user]jERq[/user] <>9AABhU"8/^8"bge_%`Q&ei\U+sS?dT_#f/b"YVIF8'`c7M8q(P9*Njs;[=,L;>X NKT'#nA%cH+H8&\2d&PgREln,.!&In5,CgSOTfL;FT(j[*$-:D\FU,1A$Hr0BdYD0 O<4')D8*%Ph`bmL["c)BQi`gB[<.\89t7Qffcsmk'f1Ok%[K`__\SMBq:TMMB^Y6+ ).SZRH>UKWoe@a,0:_l-U>.DNY[WIE0*ldPJb.mF-`c1]\$_T#P[]G),T)\;W/bBK 5%S3sU!QCH=6!$[$RGm-<6,1o]n*X7YCaUQHObYt>`#US=-0(Nb`=9rj^FZQ:eh.F WtenD"8-]/\\c.GBKR%#X<'ngd:G%eNpBp4&l0quoWE6mi)WU4]8br>WkG^9AFAGm =O/h@(Go(aa7emY^9lT^k%2]9c(h;:[c_k7qc4ZlgOVJ`B-=+q"'JkE5]_)m]$u?? r'W>+9.k5.!9lK6Ch$EsqCN1O7CW(7cI^=tX#tgh_Z/;lp8FkW.h2X&:BqYi?PM!, #U(VA#?KO?"2[F--Lod?[<>BKDqF6bfi]E0WX0!MXbqpOeS9G3G<E2-!*=;PV-k"> 49Fft*c!?$[+),2Dn'/_h=!#^[aUe;PPgR3rS5HfF78:@[user]0[/user]-@[user]fUm[/user]/,6)P#D\oLk_Co ?J9qlGo36EMZ]gd?hj3a%gO*MX7uTj#Z)um]aI,t)!j[:nKgO6ZfPW12e*kc_1@5D Xr)Vu7I8C4g79g5?(2e-hnQZgJI379cleXt7.D<8aE/DHQn9-O]S3$h--hOJ@^7$3 N'1@r6PnEB0/l#"Z_!*\o3d=K&8e6IYW^eYWI60t*t3q<\43Wj"N>ir(#"T_Ig?3a L+bg!KqJe$H(h[3Q3,GDf6Fo>,48p%6gp3Y.cEAD>:0&.OO2gB-OA/"6>h&UH%ob) +*)Kbcd=XDaP.h@0o0$WW0Qf5'SAqb`CM2m#QJ2T2NQ*A4-WTc2,8(JfW'("E&P4K Vb=1X*hk8/KKJB!fAQ!'0H9`5"jX$!1V/4-.+ckNLV8e-_<Wi*Xr-M=PU0\l,#$M) J^00XFE^8Eb!2f>VW(e5="`IGZ`pW#rI3\THlu&u%XVAu+obg7Q\CUjg^)#H&8GBg 1N0SY0hg^9e6=Z5[s!(;ro;ibH$iXgB+MB/li+5:3h(r'fh`*HN2uGL(k1^U-hP)? ])-:,45!$5gVn+k"t[m=Jq,.$S:ii*U7hSi/#;\2)YnX/1Bc"3U6AN]]s(bQkmjQj P%4RbW6&),JOVh)*is%oec(3e+!2141bj"dRVjfgW*fJ?RdWIk0G=C/YT:';='pYQ 37<n*c?bR([D/cJOeh#_#\Gm`0QIU,3#&,.7i+C$0SIN*rl,C%mp.>C.-E7ToP&[l HhD7Rd<b.bUgPi;lD0PtVd#8kX*P:`\TPC;&AI2g<Wrt"MWFae.egPTmf+!(10Zs9 U*lC88[@[user]A[/user]%Q*B%Y'g_U"!pK*ck16rP+h4n^9Q@UT3+H>%+2r1B6r,2!D,'&;[I$,8 BqNnBE>e/-)Xhn-K1>9mb<V7,YPVI%F$_1mTuiO_T%05<-A_Q%We&aCO1o/J2d,]A 3gA$8%$5@BU#(Cs@Z&aek\P;*lAD(><tGVO`ksWk(?$AjdHmq*icTPah=jh6hnX8q TL(1o$g$k^;OS"KS'B&Nbf:"$@[user]^[/user]>#R$2P<QZ\f=lKQ;p4<P7XPTP\>5jH;!u=?:70 T6]M/hOX@%WQdOH<oD#'mu+E-3rG'u=ReARi/*LP=qWK[Pj\SlnFa,FF#]%99Cha! nsQGmL1=>_s5"^`gkDs:Q$d"C_fVWJQq`)*.ZAmdO,fgD(jcC@iJ>!t;sEk^^hQo3 KbHB&]R`H3n/C;;9%rcAL+<3")'TA7nZau]FKDpb(e0cs09lV:$;9t.>Ndq1N>)]% (0Wf]l_"j@Z^r#*i",8%r0$,R[7lPS.B,Cap#r'uf?Yd+37(IYD#1c0r_=/]XCiq4 i&.u39qAI0/eBmMp_D=qKJ`SUO#i+V9=#B5@==B_qMb1P%*e9ShaBj<C\"eqK/MsF <S#Woi^&UIqP1t1?h/J#VZ:4IN=H-"G%>X'[F8b#[X36ShSaSBWHE>CDlW^W>]sj$ nXo[qrX8AI:bQ.>$ZP"k%/pW(F=]<@[user]6XF[/user]",d2Leu4.2oFUN.$*jO?kh^u`oH3pcEV 1R98YN]?Q=k7+oglOo"%X.ok:/ERV@<f!Ll?NB1M(=l*:LcgOQ^_@]+Ya7%5pbDIU L.UbE5=Xj['n\`sE2S0m?T.ccq_]Q/roh>3]S\[Zjsq=OO))s%O2_LufAI_*a=N#^ R[9[^f0nk9*Vg#^Y-[2eM#7C=+.`#7l:81oDOZSBT8>K$d[S2<FEje^p+]C^*)oHb -IfAI"W4p-NiK*=0ZKqiof?+G\q_Y2<H#sY5'#I/O[FH1N[hoh^tlADY/P,<@[user]2dp_[/user] _^.`?l+^(Kn&Bn\s$$hn\8IVr3o&*^^L4E^nULd4qg[IeBPhc5KZ0Zh[Mic)['LKT mt,e>/F=:"4hKZ*`8Y&5:Vlep*Z>?S\ZV4=q%^82Q?ET>'8-fnlQGj$VUe'`kQmW, iaE3Q)=tia.Hs8<.`;/klnBM%kF_jZib!R4lalG_/^`)bGEs;DOV1/;RrnEeL=\dP N5>#ToTMY$T(Z.>]$j][UEC&<`K+C;5>88A.UiSL(5L8X]iI7Tcgmdp89dlM$2ST1 @[user]p[/user]$QC[Y^1h?QWN*:5k:TWY=V2dNVDJB8S2\?bC.FF2,seZ<>.BG5,o\(FOrWY6Cue aCZ^SB0E"tI1%pemAC!$/kEf\fL5fYr;l;ZJ.0k)&uNHF%Glo8'8nP5h&lqWHM$Q" KDk#Rh.G<!Dp*=ShdJ[#+I=cKr"s^4&^23Ea@aQK*?E!&*5KoJ:1s-u1OBbN`iC%I Ffj5-J-E$p!&OE?7WH),_O_p2B@8p+l^N6mbpk!U)#]+Zp(N/o@AG4^@[user]6c-_1K[/user]'I5 R['H#-LYEq'/dC]rL)l(:O+n$YT"FH`G9/<o"T\hJG3aqN>4+HNKTd(Z=]DEi8Pmk .RH7F-JAVl9b,1Q8@385UQeWNo^0rbWu/k71c(cg`Kq]:,E+Ii`-CM*j#+&0XC^Vj $lk]o9OT-QL8Se),V3GpMC'.nSB>nA(?stR/U1Od3p&P,UAJ0bWH[2J;0Z=XZVAZ[ 5lHAYZZT?M\fgLb05'Q<1q,/@LO[0`>(0+H=iK`5F(`a&]4>XC>A%\chE=E`G8R@$ 5E@)igk]mikdHlS5qfr<d:&+b@O;N*^r<et6^g%t+iFa]@[user]53G2-g3quZnWsRpb[/user]FEc KC,bf<.tN5-K\i4q)01N@-F]gJmA3X%fDg^C(H3u]#(>uheprp7_SAKY-K7]."^YZ ,:6i%HiXi@rK&rFW!c?M"^fX?fJZ39F`\NKNJX$"$pkYRW/,sj'N?d%Dh6<g9Pf;Q 9mlZip"X\9mOg=js5*^gH[b^:pH.8@pju:m(CG@%AnE7238AE2]=R5:`^*A/nlK$R SYJ&>:<H"BpQ(A#X$SG+6#39;ZJ[Wn,G_+[)L`43B&2m_BL$M1eDMWK;SX4[:ZOOe _&l5#LTt6AnE3!jIfU76kKlp!%32]^%Y_Mt]TBr8/AMi9,Gh/M1?WCmWBl=fluFYE :Y6!/haH,=(?LXk/<,KM5%ggq*XWS6TV9^+kDRtk/=<RpqTE(kQ+,+u"0?9a20tq3 4i=Z!8LbRmj(Zb4h>[n*1EP^?lY*!0PA$78E]'(;-l&5UeG`9&%->TN=94b&mTmh) *(L+%QE/n@OV'osZVFF#i>I9EZreoVnuqUUEc:9<]o<.s`.TY\"[\`H-_K$riPo\_ Yg\2^q1,4&IpimU\/7:[;W80HE-`inI%_1:7#O:u&#\BU_HZHTn:cbg`=+c40c&O] ]M@\B.CEN"A7?/NMD%l#_KN`bEY*&^(lu\sJp&bq#sO[7ns89Q&D\$5-<QL1foY`C XHsjrV':"\4&h>uWpG7_nhiOK!2@QKpCQLm;9lD\(&AY9^`QZfAD7%$6\4>O92;Ru =F@WgE(/OpF5ZnJpX473>^!:-J#/t(o8_jtl49E;Zfcu>HhV4D<3(/q.]cVCm/Gq( ]3Pqb\<M4_:Yfu$qtXN$iQJ\afLY1DV"5PkR0_f5<Qp(&aKm:B.fP'o?=_]0l;Q%[ @[user]ND[/user]%J:kBEa6N=6D&*4f_;pcE(^fOP2FPJ=cs)'&G.TpH_]@[user]^^ngPR[/user]#8*:K$IJhNF` Y9!VVKZC)PTA]<@"V0-<4Q$LP]gaO$^anua2"6>*e+j/9N8Z!!";!]2*]<NM=fFl^ VICO9-)P1d,TO"^'+m8;iE9BO*;M&]U[Q,k/UROs7>W*NUPN:H=9_O=jCDm1QV>#M r1o3SA_!u?5I"@[user]i[/user]/10Vb7Ennd%meZ5mlh\T@"U(>;TEmIUtn13Q\@[user]Uq[/user]!I)mTXh1IJ [I?,#]MV+93o6@#J/H8@Rh"tcYME1(n0&lMEBV7XHFbV=qi';e*QO(l6ZIFbN7/ui VIa]Xj7+7+o\Uc3@jb$iSL2(S)j=\SR(F(VSV17eA3hkN"("ASajs8"?'4>cZVFOh .KhMqqJ1%&OUOJe:"de$#t)\$I(mO`&I.-E9p"2+]J$`m/$s>t,(9iV(eoT;e8';a n7<.\1,.5'EL8^@[user]M8M_[/user]$DAL_6LJGg6`0'\!NdIcFc[9Vm4C/Gn'$jP!'?!/0&Y]i_ "#s%eNl:i!FB-dhS3f&2<):SjWA6Q+@[user]tU[/user].594N?Z(i>fgFthZQC15e>U9'%N[BSGI 2^sn>P,S:5Il::@@[user]R2[/user]*1nkjB@EQq@GK=5$"Tk6$)f/hF((2CHi*Vl&AAC)pd"t#8D OW*7"7`hD6k@ngB3t%b,a9uTDY.<,_YJqIDjdEYQg=PeJlt[o5o@4WKj'0@G,$*_? \5Jbt4R?Qc&mNao2mL;ph*aoJaaM]l(I,4`I<m_R5!p6V#JGqt@3bZ8_.^-=d<;0s #WRQh03'"6Mh,3k97i0IkZiKY]r]k<7_>#KOb=&+A;B;-TS#HnEYcJRnKd_B?S->8 "!%IG0X_'Ab$A\KO)?j_cH,sAENB@fj7`t1oN>V]cSFTo!$b6ED9!6dE7S!/9B[V0 jA$KEYDQ_p7=+)2-4Eui#W9K4c!c^M$p6oiHJ%V-]X6:?WWlf-d/Nb[A?i'ZO51`\ iUm(fNe6h\+lll4Y>Q7A8gJA4Hq@csIVqZA85ik1#ci\SIA4B15?KUQp`_$uFtu4e lf;Kjr3:t2k6o?U$TMRq*&?]TnmRe[bG9?i8Fm..QqsR7I-SWm$aR&ZjV)>hY;o:3 /=JRmVc&tDeSpko7;!TgV`L^2-0i);7e,^`CX(%()NuCH`$Uqj)k9!iqDoSl[*?'E Hi>["nF!-^mo=+9S#<mnG(2niXqp/(FUYD1*eNf(ahBT7ol,l/`L':628qMdUt;b2 ^TDg/g:N3`EH0q\.B>DHe2oT2m;9MgWGT.GIeT/of6qRN(7t.[+/<UTp!(YED-D1R B/9B%>ZQrEh(W"[BODO&K6R^`_J=ES`Q:ZB.`4u3Omc:iK+'\uR)\-\ZV(AG6slZU c)1s8MNZRZVkbTXY=qa6O0*Ui?[B?K_O'!Qf#jS&?#TEgdJ-^reg9UaKW8aGS$h`$ 9djud3r'd'M>J/YMWG[H?S`?V=aUnq=%hNkF&cX#&]YH&geYl5(L$4EG?qiWJqo1M Lj4gn/qT"gj$+LYk:.6,m!'?<e=/-"F7^0aSuM@@[user]Z^t[/user]#$$/!M6]^*oR4m#T-\sEI> i-+!!LTGO>iVP@5SV2HG\fYP5Z.S9aUS65Cm4Qf<2r#ge[k<89(D`Jc>Bdc\^[kp, [W/6grN^R<)VXB=)W0tBB[5.k)\ZosC_rH!lEma[gnt5&gE@S(-kdtc`@[user]O[/user]#)qnmVQ `RMLFT?45bXP8o&PF@_tQk5RtVD,%,\Y6CFl$S]'U#iZC[d/Q0DbWJsn@:qm;fm6; fe#V\5GWojS)T0F:n4uas)l[6F`?>Q3bTi\S08okU5;@[user]^-[/user]q@""WcCKW=UR`H8-P"6 Qra!HC46uJgZ\AH<-+"cc'"j-8rRDW0"[q/k#H9$I4mH&.QJq$2EWSipJDC*jpR/c g9XMO/`4(HpP!>Z.mn)Rl`Putb`KMq'PU8=#Z#d=4R$"0&qmY$?5#nprdSboJ6%tD (IF?#67rRQ>B1Jc+[.N1KFhGXI%g15F2P3nDYGa4pf3!=PsX\0CEi<Tc_#*"Q)ac< Sjt5ikK'>Jj1%RTTq(]rd]52QW\]QjRb%uT&2hdJT^&d8;-\rQ0U=U&U4<q>9k+9f V,7q+7S0>7i(,[cA]7VjXHXm5N*@[user]D[/user]:(M)h9A20g1U<itD0p0kg1neo@F^NIC3ci'f i0a=%^Uh%gl@/K>kBuH_/&uYL"MYlI6!lic_CuAU5/T,h')_N$0aiW;686p;DAb=? >N3G>Im,<0br=<UfhF*"=pf/3I_TB8EEZ+Z:/#E&/h<f&<F=;4=aOLYpZRP4Alf9+ a'_@*@[user]H9[/user]&c&S`L/[GMeJ;PW(k>D"TmqbU'S<Upb%cMu9Gqdu(33ul8:<,^BaWq$W& eu5c@[O(U3SD0X#]I5OaETE&eIAt5bWr<rrC[14dG$d*j]]XUa9O_lmcK01Ph1<A! ,t=6BH;/bNkn:ZV/op':eA-H;Bt?U\E:ED>rYD?@[user]V[/user]<6oOf.(jE,3D4Z3Do!9HsC&- ;7>D;d1dVNLI'G=*9dp0Q[;CC9mZ'r0;TN-lVc=#%m7+qd3YM6nOi'9de*po&K-Ka dgOcll'bS+"&D\IDH?HLNE=k?/'RgH3+Go`WmI+1\Bn'PCrNd/"$HJ-P7@j`,9M_: &[KA8?[qt]3-Wc^.g2b]dtHYY?"eF'Vr:=qXCY8T<l%J8=M+0+"P/A6YL@$15-8:6 MbBj3gKmd_/RK='>e;t8>(5$4?)+Fn^ouYh[jhVdCN"=)esb&&.r(@[user][[/user],RF>T6YgI> ,HI30gfjpUCdu96Wd.mMHoIhfDC8$ajh%A3G;HP:SU>^lF69S(hQ9&W><#E*W;orn =U69FG<<S?K$E3j2"RZW$r%t!VG2dlStOKPckoal#Ahbo12+BXYEkkRYX)2[d)>I] qdc]M;jtZtcB`)4cf`*a-<ql]U]VU0N#X25@,M4]24*EAafc=(;dZ90-kjTC'?3:j l+42pnWIa4g@O'a(NBsqUti*kW^aa%lr_S-oi\K%\G`C`,eK?ISkP>L=;>9KT:WXZ o3',`[4W&(29$XOV>6S0Lhq51X::RZ16&<Vr@ks+TO)p8Jt^HI>%q<<d+61naqX\R _Se<sAaC;M5t2/A8W#tP:XDlIoaARWTe[o@pC%MKj;o^kVd2$AmmaomR1C1o&^OM3 peZ0?J4[+Ir]e&;Z9Dp,0=uWfl$[SMcI(kI8QT/[YN9toS14EMhKPR)ID+lpo_uqd Q\0tR0te[&C*Bf]C@8;eE1`<MdosY_?5ECfLSCe*9^)0"+4bh4bKil2lEl\SoJWDX h;#f!^5<5F57.:VY_G!.0r`2?oPZOZ:EdVo@YS7'[XN#b[`j^]do0.RUXIULV&30+ 8,JaD\s13M9^(pR/5QINbV^XRNH+]'_p>2'L0,htg9QT!*&Wkq2p)KRQASr4108MW e!'>479(\c]4@F<HY2l[%l<c4[2BnMd[YnRV_kAf%X4I^2Ce%YN4nsj3sV'%(7pGd b7rZo](PEKX\oH5hV$nFa&5?qBZ1tUjGZqTfh.%dUI0.O]<m[ba1T.ECb\M/??1@H <YM*jYt6!jR<a4o/Fh<s,$mn>9j-IW8kHZP!Zg8+0leoX0iC'POE]bfpoN+"LGk[D Bltl+flZcE,J-/iMClojNA&N1]X?s]eE^>!Y,g=4]^s549n,bfd-23FkAB(MD,qZ1 YAaF>](4@IYC:fY$@[user]3BN[/user]'f4%rT8FB+F2-:m(O^S9r4DMLjiR5"#%.B.2>b!0Z81`: YnCYW)<HTK0]3iP5c9H[&oWUgG]`GINZRECpB2JO@JC.RJ;7\s3XG4VfZdnAW)fPu 57J4><1$uc+O63D%@=3#EHh^0n95O,]tE?k#7%^i)]<AW\gobVTU")(:Q%FuUU.^" jVJGW$TNbpH('N#FW;I_WSAUB\R+%t.aCEX2ue7,*&D#p=Na8@XDtmk>kgDLZnHhg Ep:UBqm"s`mS76;=JMsfgo,oal=k$U05GZhXjR(ji\AF$kIG-$':GEVOh50B#-Jd7 A>^).quhBoDWL9+FaA>f)ZOZMSJm8n;A"D:Ct8uBrA2;7/Ep]O?F%h-_<T.[lT_*W C,,BeqKO$Go>-9L?0tG[Tl_)4.>`h9PRXF69<:A5_EjOl5RVM3'L4aX%ON`QD^CE6 DtL#!4*+aLN!F:;8\>$j4=1:V:B7oNJ[Za*1_3t$\:_gE:-jj^#1..Y?*0;RI/F7t UZb3+pi97E:imLO^u!s5&a`F\cPBJ`/59L_*`T[K*a!qTYZHqZ*+B!`-_\="Z[8YG AIkfVFTq`2_NOL4Um>'n^,q4VG:X3g&e.H&=M-3QimBq4J?d+DL^nO24CkN2Ra#T^ Kl4!clk&]30.Y1[^Ibh]U`"iBJgK5-9R6sX4X_`<THk<Ek/8cVh?hTu/SGUjD5?:U *<Em>52^AU?_Ft*qRmsd1!D?A[`HkZJK09J0UouAATQ6"?//8DD&_G$)PI.0J#8(' &%Y+<r'mD08o?Ji,T9cMJo+ntW#W*JZjk7UA;E-F/*])6^FaCg:3CoK[kRXJ!ft7e O:HskmVA[mDo/t1>UQt$;C+'K4.[;D[Zm.IN/_>+[6B.^.Th53SCb46Mp]WUVgABe Ai9KB\:ER9`3^cWO9\?(m^[J7K^_bNNY?JA*-M)ZcL\N?J!`)L.RpPS]&M+%Y&p$6 3%+Cii$d][,AB]E+44pHg2hW7mb-WX.s<O1%QV#Udh;!OHuU;=i!gO!,qs-d*(hq@ /(9<>$e&pnCd>U`^'5N,X\[V`_1J.:HnA\GmR*aoKps,ZH=D7s]>GE:7TM&$nY!n0 MZ)l7jf`i5^LuT0+sFU;FO7d4k1H?!_HL,"JoE(Rs*e(q*4JukoO,-lZ.^4AJR]5b @[user]`[/user]$&[pks7YZIP?NKi:+HJU*.!MY@j(E\79d\ElR+]\W:='8W0\UT^%_$p([F+J[E% 'gWBOp'nJPQ$[/R`N0Eg%WXois'NPR*%epWf8hl_ao<Nsg4Q-2Y:qN3GL>=Nq%[&R >oq2W!hr"YI"he:=<<'G(dJY;.a$7_C1DWZ&Q&Y3Qr:&IFS_B51WdRMSVb?6&Ig?G AP!S4ck%-i,X-IAF4YK$l1s_0BW%Ecgct3k]B>^]IHULQ3Ti4q!TX!-DkR?,OrW3H rbj]qhl57#8T4p9AO.2jdF"8uiK8G%:X:dHdJLc_^"K>C'M0\LjAXYVR3p"3),c+X /a0*c*dBr<=VP3_r=eKa&&A'KgVst@1f+9l4P=EQ$@[user]GLFflh[/user]?#(A5+nmJFANnTCpS 8OIat'&pT=N->b6+bcGi1uirF.P[uCnbQDg!Er:RL(sjF!DqTQ*Zs4R7CF$l@PPVB #!f[m?+(=JUJ?c2jtQ9;2P\.%^pdq!Dr9EQhGUVTI&iXaptpOV`T2f26\V0<_r)nZ ?Nu";#1RG?/>A#"F_hY[;Jo2`BDMi1d^4Zk;g>//KW`>]kpJ?aeb-D9O?dY!qne%6 l2g]d"rZVNe<EoKY>oM@g9gn3io2#75qZ9$mqBZJe;@[user]OA[/user]#5Q-GEU3a0Xi0iVkjfG- WMpW1%+'"$%Qnmt7ES[K0Om$nSruj1;l*">03sbNU#;4>>'aFXT0,KM)]5C0X5'SW mG<PEj"S&nnO-++><?,!75-/k(P7MI9\q"g$O*<=E\7YA?#FSdq(#0;!P=>/kK$N. k`R#0%kdYlh&hlJg'Eo/1G$'VrQEQk;M?/l(i)%1S)DVs<5?VrU:pXU2$cQtoS9*5 J,jG.'Md:(dQ6m<IHD&fHObX(ds=CcmPYS&:B\EHoTPK[nc^S_UTAga9nGisAsts! `C.L$2r*bsN!6GFRJ($5WM,2)<oVg8Ap'kVL(H.7&r-X\GW_l#JbjBD2`tg3N1!NN k2M%l;(H`Rn<'L%)K:fo)1E"NC$:QNNOB+dT0&M]<-2NRFA[n>dLWEf73g-L]d,b9 /q\0pY#m7Kh!_SZ17VO*P:?='9$D`Aq-sFQ*K01[>2@g)'a0*]qcP^f08ST/_h=L5 rTKA]0"KRNqVZ@geC&pF_1uVKp+dNkit?"K5kdYb''moXmG%(pYek\qMUGpfMA983 bH>CH3pJo4[q&i5KgtVSNFL.`s0N;nor2X-lhHPY3Sd)7mQ\T_jVV;>8=WAP_@:Z` 5'1a!bJD:c+8n<HJ2ir1KbNjDr/#LceNmS#D8_9gD@X_@IISU"l,6"8k<e.cU/Td] W#)@[user]d[/user]i@:R<l=9*V0;)Ai4l0W2-'$(?b6@T*c<\YF9$$7mf3W2Y.?4#\`!5j$%=4i9 6bjq3k._0CbtkkM?nZG#qSUXD1I'$md]!-dgi((W3^Uh(VkrS<6u3L`)tjZgn1ti? SdG+[A4g(`A!g`5T;eE=@[user]ANf[/user]?XMqpiVr@:+PppF"\TF0kJ^]<"&Uj2Q$j:!WEFD;M n#A5MCPk!J'WAud=Xkh#gCG.1ZV<C+c$nfL@Z?5YpQ"l#6RVMr:F*&0edYCHY^6j[ c9it!=B7-/J5&LHEa5fDb]nkgFN[r$"3NPg7ucJ.gY%:`[A]pIGtVm_>#`1d-0/A" SO5d&hFYF]!ihVq&Y-+ehj/OWaE-.&&TT9=NJ)^#QmdB\Pb6W6=Q3^HeJ^2j`VP:s Q>-j<c<X,u8qh*ej'grA,>j^oiChP2[C6t-X\baS;WS<6#=ZE7ba%MW8pA`S6XZ`i Io!5V_!-W[Ttt%rgg_1u/P9A.]S]T(7aBOgK$Ih]^$OK)'NGJ5\>ltb:I*H"fdL2o -ni3#aZ<D;.6L0hkp/DA#99*@#?\&#;i[ik0I_:GJ-ZH%3e'LJ+8'%R8_7`'c$9ia mn>r/MJl\Ws6B(AlfEKEUI`'(V5"X`9l[\D&U)j);KjVO^Tc-GN7es*Mp2C:&5\(a P:E%mQ+o),CUH-$%C&F,**2#+Beg(?8khmfQ8UL=[Ag!6Gr&g5%3-hQ"68aHW&X@p i5kTs?U*lWX[ZJQC8,8,\@[user]Vcb98DlUIa1RG[/user];7@2J^,Y!Uo)r#liHRuH5j>_H_6$lD Tc3(liVXi6prM!5=I-=(\9(Xun"`)0S?mTSIU2XXi:L1.Ko9kU7;&VC`)alCgRGQh @:T_Q?slBDf:?i^&>50:ar`D!-WkO$b+sa(!.;V+RrJ2K!+1-0#_##"^J=U6R6a\% %Te;IKCaju^gnr7SH:/&7&t^P6F5Aks!(,3>UaU!*Fs`E<tuJ$'g8HUcC@%eF,nj< YlB^I_]qa8ro(Nnqa5s@dhcGJIHHn9.--FKhQqA<hH,\5-Np+!Ct:Fa\>t(3q\Y)M &!!o\jYm5CZ]YXc<._cnKf%<@[user]d[/user]#clZdZ>9sd%KaFYS8[o@):a\AKtI"EdR7#K8"HA >:l!0Wh?_lXR2h!?V2nt$&E`rH@%lYkT0Ag'T<6YQB$-C($Ga`n97@COuo/SDLA\: *dK1SAQIV5lH3hpPmL%"\^ZlfK9rY`HHE^VIeFiZ#le854Ug5e![ACe3YoZ\X4a3" .'D5d*>hS@%CIY;9;0'607?*T[$773WqDa=.o>%4Soda'%R;r>TKYE,/:spma6f+X S0a$Y)*0X:7KWP;6GpVg)$9#cS8\&Q6X=:)3;s@*-\^c0kP6f*HiRs?(GI!nJAU4h m]Q9;1q^8c%a:a&oFeB'>$H,+<1Gb(KPs%7EZcb_E-uRqpK7X!'(,IS[m'/4nRJ#K S'A_I'#iqG@?BAYA1+FRqYOeN2D<:<lXrk7Pr!8\AdLXoqp[I?lAVPAgf$NDc<[o7 [P@rb(-/>*p$=+dHUm92*kHd$>ZskMq3lZMk+tb;,+1=X4Qe8o+>IS@-0OXj`E'6[ e;M-_EfrFNR@gjP%`7-8\o5"QVtSs:$$Ar"?mm%4n;]X'@p@D=9e"+oHgnEM<H'8` S*tA.C?it%3!7@KFf'd9cF$5U-Ue'`e^_+?Y)cHaJI'?o*=.`,+URUm[>8LIC9&V9 %cZ6C[CkCY"G@$tH%[:n+eYd`f<h]_<U8@[drX@5\MqCheChV*bjTr*msOQlp\jr] Iu7i!]'(=6V3_mK%AhOoE#9'+&9n&mQU2(0O,Y(_pqYnN^t:1V[o5trrV0Z\p)t)` 5s;XQoiYZdP.`@[user]pOE[[/user]*$la.!jI`(T*AP_P!$`[VEb!=i$1$*neO?Y@jL'CL2TF!_k bcF/S1:)D#^RAX5H&p/mi54SN1aVb(DAf[*jocLk5SZ^!Y,90-llthI(5)0,-mSC% [?+?"pOgJP3V]@[user]s2o[/user],Id5J:S$;6aj+0G7uY;BfAOln/pZi5K!k5$7Ab*Q35r"b)#U 8a'V1qMc-/k/UGB0DPrdKY"qIF,*-.R#Sg5*UruUHo.cl7\@=bmO-qE^TBd?Q`b^( VhQR[&B]/\YG(F>"Abbt7HhIa/4G+uP/?-!@$J/9Em<H)f_^k,=1qtRcs=9.!uf<I J3Z^6"'N"`6`@$`3^tZa7:+bZ`;UE&TZ-=d<E%+A?WhpB2jTW4QW"`4$.OpR[6@-V _=u!"lfeu77YaeZ8d9-/jnj,fA,"ROfU:Wp&tVFT%iMY:=-H$OFMbMd(Zhb=R3oDO YWP-[7ma4L*k*XiO<.?,j,C&sXWab,bDLnqS7J$Y*hSlA^I)ssXY"I,WmfrZIA\nb gf)3TQJd!mI44Pn@RWoVB9a:5CG%O(oiI0S/i+Te:5YJAH1d;:M&i!Dj[.i&F/Z>u &W_dI^nc#p9d(`$_-k8R@8106eolU?Y\QL7A4g5G>??#SV]EgiN@hn.infDf"'OUc ;`:o3f%B:NG[:52Z2-6rg]88qFJ+:D`t/:Wbi\Y514hb\]"jRnB8"srI12-&0bG@p <U*m&WoZXLZ`?8kji/[e$"Ljs]p$n<7WbsucVM"Ap>bGHL9VWa74?NH)1GDLc#TuW ]bJ`WM7>.<0>N,L'i)8jI&^%>Ra=>TUmQ[;G[`1+57-G%Mnu[uF-&NOMtr!/<=Qjb ds-`/<!dd:0^O=!pAo0:9<GrUG4%UE*$eQOQ9/8C;TQHKj;5V#5gDJ(YhW:K4t.\q d.!dc[[?OV9ME(ckNZKon&T>i+u8CeO]nR@,]mZ/("DSGcAkF(8.5t=MO"%IZZYPa _=lW.lcf0O5B&".VEo6^0APX.>5K>Id(8d/?*nS\4)f-PAg)2(TIogi=4;[3hFI2; 2^>oE,tLLb:dED>ZIL^p.+9W3[kGHo[JT>$?TLFEAr!/RAC`h'SGp+;I<s@/bf5;q -Xm-fB0rUcZlEen>eR`u?Qt>cM%p</'3"LSFmQ:"L7A):nLe,?oF5lpF?_1pB":oe [RTl"!jBYRkMRHfL7kh!ZedM`G(H5;90gH1P`nJYI82"k-%W=R+;Td[5g5u%8jinq Q2+MVGAq"1;k!8lo45sPYp:mK2*S?#9ZM$81Sq[__mQ&c]n>)r:bYFPpd/CAbHJmg ,E=\oIP%Z+h'\-',cErCZRJCBrd5&oJLU`R;K?HoU(7t^;9,?^!5q.J1iXNJ'9lef ;''`q2/u.J:3CGZ;I$RWP\FTO2d:WXZF.0F):;A<N?;&g5(r,SO;U4j4aG0P4=.kB ?.9m7Ms4gpK9*DZPX?=!9g!\.=HbuSjM6)B'5pe]0tpnFbT4R@_\;E$8)Wl11P5*N d.eknLt*Vq,[KY%Ks_=QrmHn4+L0E4iM5Yh,CEJ"0&3;nEG"^nBZB5@$W"D-P.2+_ @[user]h66b5[/user](R\?26[i)(bstIl3ZGC]@@&L\2>ZZU;A0ecF$lZE;8-Pj5-4f.=k_!O]t/C P9gB04`"-O:T[PVI&pO:42e7S)M?/R#AV[ig[uN+_g08[TAifRGX$#<m0DkU,h#RV Y+R;/HpSZ"42O4o\V]?LkGI-8^*hCScR\8/7/eglIc2#bj5HEtG>ppeA%cFo\5K:c UuXl8TZPRtW\B.dCLn*]9K3eEP]A-hAnU.*k_odnfoqG(d1*UA>`Pq@*Q2]+lX<P5 j,\ZoMoX$J%n2KN989.jHpZROQe\[l"r&9]67*@#iFsU-:HR0L4KH-&]?53#]ct,; SE3suVgTT7c#,/%3'5l6X^YO>>)sIEBck,k]ueY42If15"%qEIl)8PL@obLYMj+[d O(jA:3rCb>JonqmRJ`;Bm.s:8$ol/t`2hBO;^s,G#W&tW%UC2!g,2Q1#KrQd47E7D ;E*I$,,,fUT7e'"U#hkj$*`1mE*s-Z'?uKkpBX&e_U4FEh)dUQ)F8jZ<F/is^ikj0 n>"Kd69u-oU[1:cFOuWNlL<1r>Zn-f>0NOa.85"`;0\1,(8^U@&l2"[aQP$;Jg9Ls 2R+,nR*ulJ$V1L*6L<)/<SQ"C:K?VoT$"_<&:^lC^3G'p\1k4Dh0Ehrh"TNR`o0d: 7^:s/;TX:a>\Zr8UtC0Y>8fB)D*U-$3UqB-5!B8.$&T+c>sL7>&$r$976AY?;im%[ ,n3BF+UjJTp,MBnaRQ9Rn#$2+&+E22Q?qW7^I!H-*1f/LgLR6&mQJsVDPa.I2$_2g ARY*phJpYVYT`slaj$=[)A#u%Ecf/`fU'CrlU1)T\B)mKmJ,]`JCQ=Z/*/pj*0:pO oRs]0@;)WP!3q>IJ680>Z"*j>-Jco8I^?TTD0VoTS2]@[user]`[/user]<0-Ym^P(NFQG*B<O`DPl <[Jdq2PeX9lh/u2;EbZ&:^$%6'e>u[Ri,OY-7k_gkoYH)d"N<henp@"/($7N?kpol ZYi8``O+nb&K[$#YNsU3Fe.b;jW!RO0+b#WG-QD[`c[Wq\t3Y^8Zup?JNVooPF6QA `IldKmAdZ*NJ&"5Dml/oVWFHkc1]*)+]Vs;3Kgrfc*!rAKZ*nq?L:TaSnFS%)ErL+ [s@m68N('13:/W$[FX'_)^+/jG69!"!o\S9U(k7.$3B3'TEK?dcHDGF+9iDaTKn$\ 9.9';/DdBgY&p5Te%0hMhCj:@[user]cLuVlY4_horLWWYT[/user](dY_cgUUTU135H'#2@Y<=#Mi [lT9rP\IZ#mOW+"P[3%?qj_l<G[HT,[a-@[user]\W9lU8[bI[/user]*"6q0@S^'AA2eLiRNoM-_6 eU0$^S<elqD$[JKq5)S9<VqoC1q=fEO*$k=T/q"Khqe([BH$='CGJmm.?141!In?8 _'jM[P_V)u.Ml(i(j97bN(_0UXf/<IliDF(-47aH`u6MQIj'h0r/n8:;:.uQ-),#( 4[b,J'&rDBK5HD_(SA2bC8W8R.)OpdB$NbIllHf$!47*o22?so+]\enaS]i7q<T"H m0=.nj#i!/YUuTCCRfM:a=S(M3g%sAYaQ<e'0H5;h@1-!qJ#ETaAIN$=4qfYZ77Rl <#QVpkq>opL*;i-r,$-B-8dp9qV\N\"k'JG<</h*3PXIVAL()/k&3lV4@h&8:>%PQ co+YQG[q`QFor<ZJ,j3:D9JJUfHaW4Z<-AL)L>+#mnaE,?7afs*#^7:M=OBd/<C;1 Y;D7tI6KF9gGQ#diUGFX]>fmfW^)A14Y*KCC;^;uPKY"Xc-iROqd2q@0-M.GJ0\`W a$IJ$csm@+6pM\#HoU34*5;SJ_WS``,h!&C3H[XNK!#G+*@[user]Y9LRoPlu1[/user].af/Zr]^l EQe\qf5OMMeml:;H*jTDWiE/>;2MW3a";g7]#0:;B"93`=%n`^X?XsY9*Uf&nVmoj ilOZ@Vt5t=Yhq[3n9qR()L&(-GqI%-K]&B3^iR?J$S<@[user]D8[/user]<H=e#"lQapSk!$IN,_' koJni\5#&ck(a_p.YLe7j3&4f'^f]qU1hlbeh,Nt&l@%^lFTcR=&fFOi3F]TgZMp! i^-nA)fOM"s)qPQP`[YQL2&6<jtXUA,IAgCJ`Z71T!kn<p]iF#0[55'k='JdfV&Lp F0nLMgQuJ#Be%8+#0J2hEHo@W,JaJ0h8qalrL["Ok17T%66g_XR@OA_,M(Q.imt/> d@dZt]BKm46#:n'L4eOI+HHh@:LSc&Jn7d>c8=C/%#fss0ZVs[_iY[Zg6cs0/qH@( \"fV,5a`2tQRnFoPki9hI,4>Ok5O5oX8;@$NYNr2<?*/k1JXF>>c<ckM!RatO7(c[ KEH1Kou(s<bK`f6<q0MTUM]uH\8dNo\<V`2VAX:6OH@<3g&N-`8;!Ipqia>lndm5_ njqgI^T5c11c7DJgHAbP_@NVmj[4pq6Quq&6a7EK\=J`#*$GLH_CQ=?b)X0s,o:B6 *b,"3pc)`Lc#>-W5X'Yf=jZE[b6"q4;h+Ri_7l_tLudK=5@mTpA;%.i^TTF4q`Am_ F[e!.E.jI:0rc@X,C!pV:`Eo#+%j855+:),6BO$H5:856N..)C:Z0qVB(_WQOng^X D6+f55S9O%2ND2b.6fC3hrZ>T6C)l!ZS*M-P'iHt7&Xg_\r)_lY-GF)>=-o8B7))i QB:RH\KsYfOg;u!C3W-.IgScX'%Tb90g!W)!>ksq^OH?ro#T,"!tB7p;Ni6+0@QY5 .`p!65;,A/poPoV3*mL>Gj/r*V*"7RRH*B/o!/FEC"m*lBcn(Bn;)\@[user]VPW5Ym75Fh[/user] h#b@:^mh@$_q@?4^'X4I+(ZnNdUBjeqs_K$5&83gAA.6(_-`h=]ser`E<]c&XH/nB [3e%mI[JTdVTeO2HcTGZU@1E*#/I(D%r==AGVMs"nAo=P*D`dS5o2b9`Jc=e_^>4c =Q\Y"!&s'>:6nU7ih>gf,50!5@,dF7Y^F@@"MCmmhh)k-V$Dfm.i9E]gQPgQm=`)X i77P!rkd-Vk'KUDV0f"U<M^b%%Inf1DBF@=Qu"Zfq/a1HlU7]N[e52jKib7iY</=f ;-9*E;JrO]MK)`gCdK%^<heUdRf/V6%Qdc3FuIhuM!dgG;L#W(2`VY__Dna#r6grU IXAtSZc+oVeS_JU`M(d^Bge%Baf,.]Of,2:9X%RS'&TT(M)OP*U0d]$3uhQ:9BLk@ 5;d9T'OEGjel4n8AYj@o\WVb!k<rk$/8TMo;-$hB@b!UN=^$$UJU6GVin0m`V))mN CrB!8C@`B.Ei'u:0?c6.,AkVTb_8]^Ht8UZ)8"a5Y`Fe+f?e$BFV!(@#52QKA(%?X 8'/4NiO-^63u7mFG7\,),F<d9ZG3-s2j+'FYaP=,rct(@[user]DW[/user]/B@i>*HG-`n^\]3[/[ C^TN0rC)tn,^7SkOQs$pi5"*JV]259NLl^)WB3J`-*qH:-sYc^k"Wuf5C&]H]<JsW 'B_iRFko[D+d=j20Frfuh+/r(SmflR7":hO*TMaSN?KcN90#C6OpFsAeCOlNKs55$ :`HjX[Jl`8&,/R)nu'ete'Hj]Ginr"`q.?YPVQeR'iYAfX"&f=I*[e;UDd!2F_?uB k$4fb?ZV6Z-PJUHfR+dc!kH,I)HSLb6J+[3_$+oC;*/Xp_e\I!rQQe^Zga]M9=L0p cnC*j=E+BmesF_5MXK(Yq92ffm&SjCRR)h%R]qWnV/?HP<?(L[c?lT_7M.BK^[;jX WnpXZq'ZE)8jIt3R&>o;DI>b(ScuncaM<+?=$3SsI9HMN4//QB4,KcLPtg4.!mc]R (,<^A]9IN6SFMDs9[b,;iuUn;%&=FX&'dO&*ME\868sRCUD-$TQlSliDK[bI8K\QE IYfa/._j>dr`MThe.3[k^@[user]u[/user]+m\2m4mk.hDD3pPeSO[U@js55;h`g(OPJci9:'7h8W j+M"!.dq+??e5i:/X@Qp@4Q#7NdO"Mb(T_?L?ARuRS[f;:m_:;`p';I`1oNkHEWUL mke/7$2H%N:-dJ3.'N?;W6Qng`P!c&'f14KeEdO`9;;ck.%7r''bj[lQlt<+!M=(r RVF@]eHdUUJDdBY=D=5gW)5i'+Gq?c.i4;I\6oIl2O[`FU#Y0\fCSC*k:X,es3\A5 Qi1MKkBG3q?G@TC7:RC9C:!e]pZ1QWpJg3Tj:?lIpb@c@NQB&a_\H*3RXr:B'#)Kr 87:D<O3X,2i1HAk'qF4b>0oFNnkq7"c'V'DgLR%B$5!`\d9)?fY^Z]A8#FQ1qsJsr l<875p6P.f#'WHjh;p:YS#j,_iCR*R*9Ch%)K>u,)p$>6,<i"&F@B]+2*\:Eq<?2l .BKHF7,t15<OZI_'848?ioDa[2[g2-fm&IZ;!a19(1674$g<Y3b=4&#fq^Fg4%N@O "o%d):I)\3(5h5l]K'"L:ZXMN@au1hLua<(.Q8=k"8pPT^3(8&DnCK0**V<L4VXV4 C[sGRZZ!-^>"hV>1AJ](Ve%3<)HS)J=^:`"AV<o;i#$o_J[gMGH)h'8nZ_;N<B#ZL U-W4?%RNr-0jg;ZAXm:NJh.+5.o&PW#OnT-d56Pa2eki2]f;NbCnTF>ah3eF26B\p 7-6ubLhgUI!*l:TeTQTqY$.UQ`XFq]11t5/F3DE&"0HSmqjQq3E*@<]3f*D\c-Ekm 07m(rLQmgslM!-sSLne$_2E$lM'/2k8\i;k8otQ'_ON</p]dV2.+h4MDA+HM.H=^A Q@(p6?OU&?b&5T)(5as9;@[user]s[YW_7AQ[/user]:?`;+!KC79Nr/*_O6;eh]0\$5L]KDll`r:3 8AJlNObnm+*[.'ek?('jl9CBPM'([d1>/at]WBl-"3JA'&ZE88C%e-=I1c4Oo/>Q? b5HBfH(HNG'@@[user]9PZZ[/user]+t_(^[Zb1X@?Z(&$)L"r5WmfZca,#-6?0/di$k*3H,S8;Bf3 -X?hf:T;rb&3_JBgTeD?cfMh)!nX>(P!-TG)$45ELLkQU*2S9'U5"PX1-[2'5"d?2 35Zh"E#ER;+@[user]iRg[/user];'b`W$+A=J%Y]-9CkTT!$oF*'M6pY7`6rS9P&1YI^m.6e.u""E V82@grh(cL`&l0Zm8YdP(*2*N4TPdD1$l;UDt);6gWoD_/Hm6cH@DaaDf1j(Kg+oT ,H(f.p_V060.[%MF%`aF-cX%:CmVt.g&d$8iWpUR^gEl^f#&9ri+^,Q@L#(2:l"$i pts'M'kUSqe*PfrS*8$[i?f#=[Z@PG?`OEUWJ>(#m_F,Ne7/NN$&(1F9=Cu3=&/@^ \;;"pYY"Vq0V1c3/r4t1m[Tk7GC_YTG`XQ<Z8T=T0&q/;U:DEf^_G&<1YFeOp%r/T U&5s5f'SUkWB=U_35R5M_/`lQKdaX1f\gdI'$-Q@Q?!^EL1SV+-GaKm4qlJk]NTn8 87=ge*qRcH`2]7=-W6eO]eKi6i9M$t]E"FV?\'9<4Ih!fdtKcN@p:;V`'kOP%8foI )dCNS!Y6^.)-/X^V$(;tD'gklP-0FLSAW\WEt$i7`]S4&`':JZ`/VOeIJZ36(3oKh B*M-fU6hH)6)'7@9[oLF3scj6.m(MUeB@`[Pf1O`WI=^]:7qPM9`0BK,/Aii-f>V3 =IfY-]N2Zpl=hIH>jo7Fs/HEIGOCDm;s1)5>Hj,jL;<3e2"E,jV0ji+&:_^Sqjh;V 'C(nXp!m)Lpc_I&2rOn=iI#=sa39o7&5F*1G<aQYY(&<\)gL4tSNY.\#!LLUShe\$ a*Fj6?GIJFfWanfPPScH22aZinVLJBW8f7YJUtRl7t2F\f9BX)g&`'8ffs<2FkSK# >M*I+1(Vi))qq_`GQ>1SO@o1^'BuD&c=&:<8l[YG7b[e(LT=E1rhuo$LUfY32]`Vb 5OKgm#5o&q)o9Ge,DMUAA4k0f/JC]2:QhC&16*5s1l`4/Xbu^!N8e$I,U?7+E6.Y_ PgD=]")Pg9?73F_Se/9V)0W>*M7"KM$1VGYo80$/2)S>b0C<-Jja&#.bT5[?:ciQj OdU*Qngkk:5I?Ke%J2VbV3m$FJISh)lm!nBAiR91T1!Ufi4aA@oWqMkeR$QpAY$&( 4;i$RJuo[<i`mg>RWsdES(3T@hD04th_]ldN9l?,%Xoo4L[/BtcrmF#,pcTnlfp)e ;0+Ac7'M+CcVemdPmOH9*[_pF/VoKb?Isa<_0$nA(q<2:&HMtO=[S6-,FVY(UM%YU 7XRhU*Beg",EGoY(UuV*1Le\2RAai\2%gs1I<(hT;e`2ff_=2Y.*km+`BuAc%3i=r NQ2j6rF,H'^k_qkX'0<"A0[Ti?DdEm73f!tLoM1f8lfDO$j!"e%iIK;%:qK9g.=T[ 8NkX"lD@;`SqGmG?DMb-dm,;&P0g.u[,d1T:BGZ:%<^*%CF=N8D'#C=#1+W-G_B"b @[user]-UhWH[/user](!qV`ep$Q_dT"u](rL#`O`Au4FBW"MR?)jeX^UGSA<`=mZ]9*&A_D;J$6'U gg@,*P=iL#'AcC1nLMJtSr#>m`8`&k$Jm)HY(6q?Q[(^<$,J(1!Z]bm_]ZljmO+/? _4.e<XVt3PnuYNUB!(.+hc+VE<V"Sl2a\4WP%t[lDk9rZ=UA#sQuJ.tK*2BPA!UY. 8X?s,MnrE1,b.al^>\eLHXLcD8=ENO`b@6La5N6nFi_(j<^ajW%./F$]Y3P!3j8_R itM*PI#k%'Y:<f[6Z)rX&VH!LQ;j'2.Wl&_%UJ3<=35R`\8lle'l^7YRW_pnc\OL$ kb"iDbIt8NQYb1TAL^H<4'Z<o]apePm6&ir;ZE;j6M2?KeK#B/(lT*^EKp/E!Fl?7 gB_ce\FO5HnFJq2Op*bE<5;$+r(kpU)q.h*`Gm&I>BqgAdhRbL;.'O8AX"=$a\+SW L:j]TQ8i2%D\IoCQqiEH3edjml3n?E"ULU=bCIE`cjc9h[%e=i&P,/r1=-IW%-NB` cc's^5.;gmfpDU+SmS)hq4Da-gTcclUPf>;dhC*I]X.eoApP<.%2)ApM\7Y.+uJ!b ask1V)a[IFgX!nQP@$Db&9n#:Unp:.JR,MGEVh/$SkC$P1#5moB##(d#iBCY=rGs' .f/;#83d?N+D`RqAi<MW6`3P@<f7&p0ZSVZ6*LjS%I@FGI&9Y%2X@\grsiiIl"XJq JUK!2GaA"9bo+<lG+i6$;=H1U:@[user]1u7[/user],o(#5Ynm;H4Ou;V!P[BG-J2p^2?objQO2P` i]7seNES[;qD&f;22>OhPeg/b@hO8$pRXZP\uje2(o+Pf\XbdC(g)F)\(M!,0C8$) _.W-/61>'RMDdI^Q%u(`[R+>I`lAG&%J;q9^me+6f$cgcEKY5sEU0R_S)Uu-#,es8 dZr2s&s?:EXP!0]b0!9H'cZ']'[UY$N1ti7!RQd*":9OVir5N:UX4]pW$h,#./F3T FZ.#jqF4s/:h^$%&tu6^k.>W*+4kC]*.6@uW"6l.,#cH%']"I[olW%te=qoKr?Fpk fRontH=[hcfWo`<`4)F:d0]cI0BI511@`&0Jr*FL/!f<](0c&!dJQj.^$PctA&Q0O !o)*ErI^-.;=l"tghTs#`digeDMOMCTT-F+Qj>^86)VsY5um/PoVr](f@[C"TPBjR R&^")h0qZ?AO0>L)HAY@9@ZH582&1c<Rl&?$n(`t?V6uk:);Yi*Z%ePV@EF[[$iSq -KD!L#2Ra*N<djRFFG997qdsa_*'#tKbs80_J_qM2!F]7>8SfeU%d]0<YV<-E*:a2 l_WMBieMB'lk;QTg@CA\%d[7oP"krtLQWU_1Ea5:G>WN7$dW</iT1mp"ekj3$iRgQ =35&&B]h("Hbe!MPYLuV>6O['T$5CXo;'Vo/_?Vr(:R9q(%XsY]&da.]/'I#UTKth :'(e14=tg3SuJ66+]1sh"Q'Apo&dja_3p=Wk+:G&-<e]?a+m/f/r-VQi'k\>(S.[, )f>e6/2/?Z17dn:(2eZ=bK/$f\XoaW$l2m@I-8HGgtDnP(#0u3f.BQ72^:m\,t=,o 7u]L(#)hkO",_6q5@_P"F&66AM9;,TKAk)9/u:>&R%!Qto(%%7+PR;aOF*2/*TpK5 dfkAm!T"Q;A?XhCUX)KRc`.F0jah'#$nj>^j'E6S.+$AGO?Y%hc9P7fJ]nedQ8n>i fE])Qhh^fLQmSf;=4S."3bB,r$UZH@A6uC*^2!<.0hsWck&OA4/fQk*Vl_t\Mp*[\ :W>nL?C$]qs)jIo/`T:C5Sp65$So2h*#os2fG96lom6Me7F^PucEJ\N&s8[Do'DOg P4Lo9]f'?AJ#>S7])~> endstream endobj 44 0 obj << /Subtype /CIDFontType0C /Filter [ /ASCII85Decode /FlateDecode ] /Length 141425 >> stream 8;S=NH$E+t*lUA$qg75phYZ1,9.1sG`4e$"8o:C>PYh80G@Dr-;bIES.&5%_p6="Z CG2ZeW+B_7L['J%ZrNYO3hB$QI7=q<a?8Y#oB/-+Es*4D6t0%u]pP+S<i9l6Z!A81 ;s`!^8h<S<*gRo?0`0H^%gmI-W.M8Ec.F</QV>g?<_LHSqC/M',N?]7bSZQCo'e(K ?_0AhBEO>D_LUe\`fLTDKZ]1@:ck>Td&I4349i]:R&&Ak<"_bkg)qc)bG^_e8k$-V FV*(0eQ(*Q<'"b>C:'`_Tk9s03U0Vo6I[4/lUk_MC,Kb.W/[`=W.U,Q7HL4<U<]Jc M7V]FY>Eh='qfH;^-URCh*V'5e;n9/#O"-h!kLM*%QXdL&D^?.+412<6UdoJ8#"%[ *fnT3:D,f"4WBrK?A)W9H3O-soP4#%oQp/lLu'F=&,ch2'`&I=9Cu63"mE/;h`LZE \e'9#rA2#UoV:EiN"m#F`+%^\jY/R2eA]qXUgTW[9IiePa)o1?_t:b:`:Qo=Lm[.g nX'a/9M?dFTpXr/242XUSX=hm@q&1pjt,YHR*1jIQnL/hQlBMK`I'&q[[8-Wo8@+9 `&r3J7pI.F"E#+4"PfHUF`?[,VDrI7g_LL2Fi8-XgKE>"iqCD5JicZ]EO\qeVrQ&8 GHSH6E*)#$&U-D+DVVq8#B4a(O5M(u4fR5C&bg4RTAb5OmS2J@\@[user]3LQ[/user]/oDhMOgpJB T$X;Rcc7PoQ[kEYpFKW,]]\cfj3>GF+^Ppj2VoqRf&>_HpE&/lnIFT-Lj'9r38Ot^ 4+h_hn#CX.Gi.N:`[eoQk]jl&a5WH*:WBT4rS%$h`G^An"b48]M]I;8pf[CFiia!p *V$W!n&=1FIo-&JjW><='`M8*08P+snZUo$K7?ht]D.*T5<Jj3Cdb@)[Nr;gfWns" Z,tY@fW*T8&c3!F&[nssB%RmO2V9it]8H!,mHrO,fYQ3KfQ?J)m#6ak,Bb+de$2QN /$N.g]*c.cRtKOX4X`3)q[rNap*03N`.!QV.Q/AqLS2?p1mFYI,j:nQXp!Q,kYEmo @&O4'$-!QN+IK<`\J!+6=?s)WJsDI+*C11O7L?L:llt(Ln,^@[user]6Jg1DD[/user]"J6<3,e-83 )8RPLhjcAeBI'r7/0SG9-`fj@>D8%CRhE.TCem#m_Vp.]#cA9[,g7N=9":&RD's^t E4^cF&0<&Y:3_rk4Q0kgY9^bUpiRjp-/h(ZYY`2`')k4BT4l0"H:.jlQ>iR<7,s,i MaT',XX;FV&oBn@3RQDGq[ji6F:ciAU*GMT-N8;=@[user]Yb_[/user]*(!\^M>GV&'E'V<`\;rb3 N']:^4QJWq*V'L!H(7PP5*6:Bm\2&&Y+t;!n(gAcoe='5H+:u+HgkM6jugHgIj.\0 Z2XbR]2$_2i$cQ1N@4!(h+146@MTVuS_/M3%O(NU,s"q5.jZbnLK!aX:JKrM!_QIj e3ZbjVK<0A0+c`c\;A/c;l0k4G#IHePjM)rNPm1X^O_&gKL$lb-".l%s/'$qb,&%> JAc=NN[8ZkM>n\IQD?tqocr].ace1R&eu<]E<qj+;n337\l3_QeS7oDJa.O1Gb:Eh :of]3^JS'0pBL;:nT7Rl0;H?1;Z9>,#S$7OBG8]EU%'Wiae\/mRcW#2JEP5)@[user]L[/user]"JL kCj^c22p%2Un4?(%W1@WFuq@;UYTtE\"`i)UckBg,!)Uk;?EC-dlE7;-0^Rgf)]uo 6MDi!LuXQ0l'XlAH1^MuT=4C*6,2:pd$K;()>".<pL_KB%-tb!/Ym#5,)_Qu)#49/ 5%4(8`a!!>)9+gIJgM^rN2oV\R!=EY?'ma4W?K`DBr@Ajc]%P@bi+glAp%^/7:nbp DH1#6b.Jb=Db"C[(0"bZhcVq!f2>a.L-P?BE@hs0@7a[h4D*g]?6@FtDCf/1TBEIg $#bd^c",Zn8(Km'ZB=JThV-#mF0(hMl<^Q;K=.1NpDW?ZP1,W(\$Fs<)e\`e,W>%& o>eM5`I#.3=iT$?[`r:Y!-Y_ZB,\AtnbrT5O(.kXm+KP<.I?B@rY,iaintsie`+pX %UUIT$U3@_OWJo"Stkh'>b,B(jA"c]+Xc3d4\f#9oEbH-PY_$o-C_@Aj+'o&C<ZQ/ NrQ9N:q(C5`^/d,;CUn9AWN]T23TFcP-iWDVj,c]hC3<qC!j)ZPQo[j]jr!`)Nnor ARq8I4GNb*ggSFu#@[user]-``p[/user]%fY>SaY5H,BgJ[>s$-=g=^C:G/K2[T4C+]m+)ZtH^3E9 amP[3GOMkbT37dHq`Tm$#\=MefV@ogj').H"7+QIrL_`K$1)pgHdTc<DIJ%+Z[k12 l500*L]*LZhY=CcY3at#p0O*a4cXqEAfldaSmtACVA.[UOpP`:BH.uf^ckP&?^?86 #/!7&nBG\V",:SY70BRU_<GAr(t9g-CW+;=N2jn]CCp0tgCfIeLO'3F?Gq&K+J+;W XdJ;[%<"e]+^L.#'/<VtZK9FA_NZljKgNB[3k(fp%XN.hRt9g%k`:@[user]I1]HEm[/user])&k8. JlskQp;3>3(p:a2\X7#^q8]bU%1>n8a8h.S@-!=oJQQXpj"^=8%48u#EWi6S0[%A> )d%P./'buD!Z%oB]T+(6@&4+/I]U0mlhaf7NR`H]SIO>/=E=sq8$M\If!W<-(CjkU T*WJ.CiI1E4ucPO@fW#6f]3.$%<,SV\(P_-$4f4C4N$<)Crq=m(O/Z.[haAHi&`$0 $M_r"rt>NW,-VedD%JN+_)g5W)BgUBC6%[]#g5R0'gud]Z6.Kc+Xb3ILfHs8(ZOJ: n.LT(On8Xq!DjUXAKt)1YsTIEkt"T:L'ob,+S.4kSmgf/AEP,V*P#e'o0C#!$IhrB (;%Rq[i@i/:r8n_!deNfcV'LFU&7#&r^PuLWhN=,K:3qLh2'eLW4ddD$e,Vp?T[Q! @/hT2gdGWk%bsP&DD^P7?iaFPj,b`#'+Xcqa?-c;U?rfO4)e.$a%UJ8#UdK/dN,76 EV_Z?<9*<hFH"$r/Y"c>KfWJOK3nl1l%[CX\?Z*9;fSoD?2=7I%G,rHUC5mD\7ppD 6epCS?<>qU`Z5HB%E:PHgil7q14F_4LH9ZjL<!m#UBFB(d,0SUI<[po0@KC]"pW*+ PmLdOi\)ste\jNUrbI/\$@[user]Gs-O[/user]/p)960X'='`=$4ciSSMa6-9Hkot;7cpDi2^?MP( oe_%<W>m+"3/s:tC:^3!5U3J[BG2#4e$mmbAdbU$d+DV"/rmm8,jqGtDeMH@:!=rD /s>ji1nH%bUraW&4$]6@1rY0Uge#,GF=tqi(SpqmoT%D-b;?ncoQ/+3,0`rXR<^XT 3R)H93NZh:R-)E9]EL-A%P<L1Kp-5uBNf4I7^f\"KU/2Sj,[a17qPr3C_&,$Tb[=C @[user]ObNhd[/user]?!R'[>\/_OL6aD18WN:aekVFMeL@4ZKnE2%V/p5%St2d'Q)dLBa&AOP;X;? M_DV%O]sHKh^=IdZt1t;(6Fk$H+T5855@[3?Q&Z`;W(+"W^f@P'V%eMSl9;8D8/bQ ="%<FOjb`$JYK8;5"%,t.F++94Xjeq,u1A67?m..ME@VY,8,0VGj@Xno&>P(^`m,e c6mj2["gItTWht=AkHKH:.d]O*#2Ei+^O?rkNo24koAo#,r%REd_elGk0:KDA>P^+ G*L.4Wlic`9&%\#A82I4L@,4`C/Zs]ePPE"]>YSLh%/.0"Z8G/CPq@*f3@]*#PoAs $QF,U'TLnp@_P1!jr!?oeNM.&EW,_8c9!tZ\kTL%=Oi,f;tY##7kWqgKpO,c-fiCU jV`)6.2LXV95F`KEN%)+IUcC/RB0?KD075+%NW0)3eKMcZ.EKD6o:^Y0-"4?Y0<3` KLj#AgEX!]pB_Vg0u]R6V&CPOP(+UQLs<+Bn[cB>KQl\B[I3b0b0(L,+]4bd]eE#3 'I"eh-9k]g]]:<<N%ZXkYN5]=2=bCuI"X212`0c\Kp4)Sb+lMZbBjCE_*oP-)[X+< QEp"9U8Z3Yma=CM2K-ZL8jkhbc[;k)6\s`#m"?&rb+=Y,'Gl"JWp&b;KS?o^BmZ,+ e3>Y*-aYk5,XJa\^2?GX.CUnO-Qtqp)\jD9YD?9@`0]W;(,Suk+0>:Ki4NM@-gDR[ s0>"'pA]ob9uY@]p\Xdl"SqlDq_pGk2DiNDK!B@mi)4Q7ZVs;oQdG59cc"J.cGUL- E2!bP-\"J,gDTQ_Jq9RZ8$EWmKXFSZ9AY3NJ&Y^`CLp/Z$Z"Q$*J"k`2dV8HbM+'9 )GHFZIM$Z*]<A`Qd`b#4OP(<r'o"#G?dhu'<36SR8</pgg:BaI:YqD/'2kC;mEbPf ,?+/Kg<LC*aj=;CQ#Skg'j4A9?]A#!TrdFb`&fK%$<+BRk46G4ejtKgQ-/5Z06ep1 R_*m>j6A-$5>#=sHG5j`nj&U=bYN]85$UcPE_q;)U"&[UWiR\`Xu,l\G%L4cGqg+@ &t2uW\UO-<kHdq\\_48.JS`ptflKBF$+>G6THl]GW?b-VcRS!E=hK&i;+>_H<Zrgt ;`=.Z`,DchB9p^.<F*?67)F"$0'd=o:C?f[D$fe3LX.H2C?j%&<[WgJA>W*DbBrl. 83<O\Pp'+G6X0k`.O'c.JmqRYJ[!3V6=^PY+@[user]3jWPZ8if[/user]&3sKT9qd/rNjc>Jm:fk+ N2YB0SN=G;k=a-h#M9p?l14;Ph"t=D^#'VA9R^(cheB0-BW98)rEYJ[AU.juC;0LW ?[WH-Vr)]$6u&Y[Q57M1jR"S^V\DQAN[8ahq1n(1[,A5Z76X[W>iS;bqK^EA\ZWXs %HST^Y:)KVD`jcC23=\gRY:1Kpi--Hr%@=^#[kdaYXO.+V@<Z]=k+*Q\M3j7WjLcE !sjBk:#tAGWj=HOWE*>[i7MLV@#f7RMH>]T.ELVZW(g`9<Nc0\rAAM1#JnOh.`R2f &2Qga"Tcp:?Xqj[S`r]i<"4UBR3tcPlCon:YJ&FO(RH0mQHAs%+7@:3T[j6G<;Fos [6h$\-/a.DMBl[t\Xq\nkbpU<I6Y5\Y4Eu!QWuSI^o-i>=]SY!f:dpDV7IGj/3/k) OVkQG>KuT]BGAp8k0Q*qCnH1^cEn^VBno[kbZHo`V[3G`qhrgRZ6uLgki:gA1Uec" B1@i3<[=OV.H:.XMJ>^Ee^iC*q(L>Xs$`u@hqq"\/P2T7*f1\^L0&mAfKFa6n2=I< 7(DYe1k.gTUTp^!USH^i]?Nit]hF]F6^6.:Pbo,tA7:nKmte>A-<EeMi)ol.32<4X _$iYWD3[jrWSkP4"Rg@Gl&/j;&j2*nab[7dj#uM;]`grM<HkSC_U88:hjZjl$W<?E G_^OK^2$k!)JV83q)&e^\t!,XJ%sVL^Z!W`r5jDp3aq8V2\Ol\e5\19Aq,.L#db.L '#'L_\*cVT27%Y%Oa""$^34..Rh-I>Ij4%TAZLTQkCk:Yk6>gHT`=?Zp9X]Ea\$,t 0`i,nKb`5JgNh^+ph`.R[MqmZ\N"]-%=)J9&?eR;P+YVn.P@ID=@[user]a5deB[/user]//gpr:1X k"&+/O:^A7-G&d3`k_No]'E,Adr.eOkJ[:+2n+(E7\>_65'm(dbT^+6E+3i''"F.1 LJGjlXuY:%/9/I<XY/:)<IUps!R=m3ek&W)P+*KEUUFPS8h3l[fbO95j'nY9*%nCX 5c</X*d:fTP9m-FFmQZHN1,k@0QY(nGc'rTXRL'T-8Bet5&t$/hLCn2CYR&^RY,pN ;o7cpri3)UH?!ZRSE53n]/S,G!@[user]a[/user].P7I>f2A2E]7NY?ggd++2[%mD>FTCoNtQu-5D M+f4IZaFXJ)Ts\\o;W<No?nXu](Ieu0-N8-8>;,":p>Ld<1.5FDe2La'g2QB*&)=: YmVqR;OQns;+3?@&BeofR3`PB""Ad9>keD+is>'Vk(4fYe+&[ZpN5V=fb`hd,L8gQ Kf>]k?%L_3'HZ7/gqK]3gJ(n5n\Puc?:^fH1/^rj"ocF!RoehY6Uc2\M)fOA#RK0* RZ'!iiGp#T$fl9=[@[user]6[/user](O_m6(]A59:f$maTt6Xiu=kl*E'*<'UD%a&-Ue45./N!CW@ +iSM9_2)Y'GS+,sr^'a#+&@[user]sl[/user]?&[[:n=&IC)!8WnY@%faBPDG8$tF`2G17kG'Iaus :i!898M/(WM@$LO)n*2sO2>,k/9]N]_&Is@Se)$B,@[user]fZ]8[/user].4?]b8rW<Hr;XD\V.c? +7i2D;7QE\BpPb-=(ni&5K=9#5E\YiM0U!)G5@qu_>ZIiSOjGf")j^roA6"%PNZ/J ),J40Uu8su2QS.Qos's;6p;*<NQT4t=/:b"i2Tl<)-+$jTh3X*65.ZVY:>>qG\29! '"bGZDB^:#[OZ<1445*^/lL856+"=3+Y/^Res]ruba>mT`C5)196Q$N+=%O'<GNS. 9=PUGF:0t+Q90@"f6cI6.pr[r$c78W1[*,!C8\W(</YTM8Og,Y=;K!EQ.;iP<mj^D UcqM&V-#Hh?^LE.RiTCp[*bG>c)=WDP*!fO.kH"^5+!N2)h0QpEYKuq0%3JumrDjY #\m4s=.bp3<jNY3($9s1>;LLG-uqIJN&&OD$+;Y_bR_Y<:Z:%j<?^L97%c+\]0mSe EMU;qM9[Z5lR]*q=-](ECFO>,_:0&q+14NW\fFQc#opQ:=PnOY52!!KEIicb-h@^R ]g\Pc"D3mc&ntSOG@3W\EnX]42!67%@N@C&`V.aOU\T91deGT3c%-8+TMOqS.WeL. s%aGIGjJ+o"_)<+Lmk,bmZS)`br)HDnW[Fso%$2t87#:a9J/M"q8s2>Tc)tXa],Gk dnI=lUDe?cl@85.[(n=%4V>JjRjHD*OjeQMof*Fi3]MGR6BaiH?Z)qpWeJ$\anL;( _YY&Ud3OVro'ogf4NRL6*DS\r.^!rF7#N;1HMVcn+N1!_m4t]d@LA#?A)8XQ#J676 F^W[`jiWM6FH2Ph2mpDk/t^1c[m'!=dq[B4,kG]>a;:pfSsBK*6U3&CK&q55%`1&/ L:?2>E5Kf<^M5GAQGRh+AW&Kl?t\hWKgKrs,A\1tB+TZ6KO*A`"G7JI#pI(o:Dq.X iIASu3LZRBM-*GDY"@[user]1[/user];PE?HiIO4L6.e9?='g:CFn`//tqFNTq/9`h?&[Oj(N^6Ld lRpbY6/QX2(^cYN>2jD@&JE7/BWX%T^L**F&jgG/s71IOrU3B\fp],iIn!uW9>q,o Rp3:37\o^VFa99s;`8SHs"8dB1Q0&tU0Id%dEAni@3O_RpqE5hp)D`[$tbUj[teek rg31*O)"7.ieV-E*TL$^`I.B+>1%uW#hl#5e8]8$_'0!b<()s&J,o]Wa<!#Y)bGP[ $A]ft=@[user]--n[/user].3h.je@=Fge^h"jZ!):G*V]<]8'dS>:_-`t3V-n/pYPl)h#"^uqg5cu p)^M+NYHZG-]!G[i:K:_T:^Ns!+`XgiYq7T]$?<t-&se3\<^W2H/0f>phFM&'pp.e h+kOsTS5*4,b>K[h-AHuFf[i8c#0IAph`)/&%Gd>T.6ZY:3fd7hGQNT;QT>uH&/R+ WZ>e+2;?d2#HHe,a[ZN]U(ne$H9?aB7ck;(-tEh:RBK9WihXV%!N1PK(UPGo31O;O :*JAeh\8+1.BcGD;0fGB3XOJ@*71T@5SL,\bK<akZq9DF.FA3\bc`qHr0/N$kTc.@ r0Ca;iRaBA4q<#[E$Z\1=g1t"^Mu^_&t.)G2^G,JUbkK:Ls/:#91<[%,e(//B^,?K D8)-c'LmXP!%,fEg6TMUbLeK&B+e;e1ML2cU(!ij?l:kWR:T<j>?OVUA$T#X#m:?c 7T'6_&F3PcWp=Xt13+n?1547.=XfgBa1_&]"/D(EYnfDW6VUMLK07D*00lZB,/g6& N5c!Sp8W"L8IJ4%UE_k.ih1Z!`IE9"'jI?P.[g_)kQd(<jk3can-D5RI?c8@i!%`+ :0gqY[j1r1A&&Vi>PO/CUeK$5/3Fb)Hq7)FZl&nTi6YXaEF9iVJWCdF;QHu0`=NNu kfsbFjT<LZJI[[S2&ue$#@[user]cQfgd[/user]")7S1doVN$N&OP7pMp80Tg1dT#HD[U7NZ)>8tC X9V$sBSME8<qrNg`j#:/r]ra'TS!ia]#+\/$;+0_ROcNPc-=>Wk-I^=R^;\JV62d* Y_"`*K];s83F1>Xq#0=?H:&)%UTWT8P;Q&>o_AKjSNpY4VAk"H`><D#`t[B-@[user]t5[/user]!_ eY/I8J.n!'lP]h"=p;qh9,A,Rm9p^qAna&#Bb[!a@RpZCJW;j^.G5"3$<VlD6)jjJ 34<(h/T1KaV3fKcdmq7]2t4^q!r2Y'AEIN91P>]X%aNEcHLXYgCh-"TXQ_D@Te-^* 9G+S>mKrI<5bbO?\)8WQFP"EsqSKW'!h`8NUo(#F7%tC7??WQI1qoF.(KK%o#1j(r JjOq!3fl`f9+VJ6UQ9mkUET1*+.ZJJ!@[user]NThfgI62ngX\[/user])R%ZPB?B)smX4(VJViFYW D;fA,/gR`-KuTcWBYk43;ngc8<*Kjf=K.^OCao``#\:c\rbQ#YZ^3?2TA4q!T8P6K NWZD7/d/Nm46"j=8YYHmBH4m?I^[,-`lr,+V?bdCU&.8ud6:mLFYYin06=`*-ZS)I B"gB?^C5MC:5"GPK.3&%r'B!=c(C0n)OEMc%U)YHVp?%>*6MLua)aEsQ,>(PW$26- 4u+hDX2Xds5TYkIW.:jGeF"[N26's_%6q+4jRj\WZ<l\LJrAe%;#<%!jE[Kt<,kfV ,$PU]jkE&O(73SPNeG,>s+RBZ.1#VX'h/HWScAEMXX"hXL%@[user]F[/user])9(,\Fi#9@'kf3:t &iPXrq4+AugtD1<n[00P64FoYb5KC.276&_;JNCD$^D%P$?#e[<PsZ27<ohp]X":! ,e#\B0s$=s2`Ba8;)rWRUr%QHg>qNc4Vt4g*+Fojk-]!;Ndor1gi3)[EVD>T@:0`, BG9pdnp/qq9]iLtZ6jF$I]p7KbW[LjMK@`s)X40fGVEoQ1Spt`lH\[=\hSEHL93)e 'YOF6PFoM2a^UR29]AJ-Q=H*_]pZcU04OTs4M#<Efs68tT#4<C:^Kgkmgtc$_dO,h ;;pJhKp<D7V%qL:5:hSb5Q2cJWdQ6o*RoHb<8&FETRB"o1!08SK=<Ia9$Bh*VI[Y] <Va3&ft,Ufb!9uk9VfK"CeWU,NdK(Pk:h;p)\keY.(M?4>o+!44Ucr)Nu8Bs16okq 6r=(F?br#gIHA0CS=1Ie_k;G86/DJDp#&A`]#M<h`1(O&_d=dTX;rQ+#F3-fiLQWk rnk]X5f9Y[hf#.aNO]ueH11sdR96*42<75u[rXO=p#3dQ8*o;G<aTYB/RtWVP?Wd6 g,AlY'%Y$n8%hCj<kEQO@9Pf9O]ML+/gI[ET@Uj/"Iun+NlECL/4-,Z1c4SP?JPU5 ]?hNmUV<7W/9]<*UX1FH-dVouZoinOE7C$'Ld?%AoYpQ9q"0>A=?'anCfnF5c2O'd $M'(rdfX27r/CZF#u'7Vr-nUGl1h)0L%^6sM&(QJmp_m5l3%HGf0C#K9+eVF#*KBm k1=Kaf<:j1P0ssWZ0Y"MEHF3D=&Pat*5"M>&WO&,Ob]p_C:aS\4LRb_F5AqFZ"'&R 40?0g'i]?mM7f465tb[_WGtnu:.@[user]m[/user]<>Fmcfp[sh**85UBh@'1TSn?Vq4Z8%4S&t!, -_U/J8',8NaI]f;7$U\APoXE=2&`7$akuq'&$_(rUM'<7Q$fP^K(>6S068<rM&P[\ 1rAda.RdVkM8mI+b_e)7[W&Q@WQQ%_j<6Ri%p`hZ[!VI21]8sk;OhLuTpobYk[#nT Re(-R]Z1F%lYDRWM`0u_HCKNR,FmH)Z9GV#^\;PK:Be.JBXr)VktWeL6W:UJ3B1VP PnM[s@"iX'?nS39.T:J(kjsh.-YJ34at!YBG$q$o2+OOhSI05tM2W+E8nAe[[]Q_? ho8mCgaro:-I4,7nJ3@o6E"=_Ng@kJ<AN$9V]iP[\_*ec/3lY$c_mM6$KL&F_:]6? fH;5gRr3i,8l^.8iE1=<N^YnaTEC/0>qAorPFQa+#>^TK[^.Nk4p'XLYJgpB_.]d1 .QaZkVQe6u:f"*f]0a<jB!-O$BF<3:%7?MS9S!92<ju&n?ND;@[user]5K[/user]&n6E"ghDa'4:` [rq"NVHjj.kmD6^?kS3W.?MtCTI&_1KE/Fg(jt:@[user]_E[/user])L9[U^DEG,:HT=gGFrCg"%q hi\rh*uIP#\_7%W-,cY/J(dIg6Gbs0g,td9ch%M]0T\!UjH';Lo6,V%hrjku+0&QP E&i)0a;?[B/T4!-gsV1Jj*gjO62]VK4I4lA0PlaaW2#K]:T8&fd\f>gq7`<KDcUp6 SA\_I*(eu%;eVV:9mh`P`k&\IdcO/Q=<bg'Oq(j6I-F*2$+<6F51'/VLhIFW4[iBY h*&"MRIX&n>gEF\OYj/-AK4]4pt+2e<st3/Bd__eB&<?7k/MBt-?J,BdqMpDg8o#M J]W\6d+,Tk,seLmR\ltP>G2^;b/]d`jWL/kSA+j-pLIcl_GR3CjQtR,`g13ir!Fe' ?EsGEcBDl##n\)SM.0n#0\G:=+6jFRQ]qhMd>f'*&qLWo;!.^L&%MI/.K@snkU3Ng #+HUW)Jul5GO`OL.pUH*pTn5;PJ-4+CY!4,EeiJ--es&]Wg]m:<N;:(>cjqW&oe#F ::aGZ]@:`/KNf]5QPN0k!ub(pA\ZU^Y!:_-$T*/JX=CUf:H/sN,$]<+e*Y+W:J83] .oqJ-<DL2mXn?jV_nCW8E(=JJ'58uKm?Sfm-kaV>FUF"LZM*b\A%4EoV5mGCb&Ps: 9=NUmZRdVip]n1IZLL99]BuqjQLB-1YV)'G[lI`#gc9.![`Y,MP#XYWBeS*+XuIVr [59k6#T!'WT=W%q$@[user]`D[/user])-jk+T`N/JUfZZ3J6KE1*8jo40f;[j'`q^pW!jpO>f"05^ d:+jSE\[E)g$E`dG;.MerH.<%`omp@V%8XPZEk&A>=/o%'b?>X+)\856q-@[user]3[/user]!</@9 DfR[6K7cC2,0nT_i#oiCNmDfHL@0RJDNG]^:&qh_#Rs4:8G%%iW>ifsifkD-j2apM 4s%"K1f,*>6A10-5c?hfk@r%0fgtYK?D#$G[nr2o,O/1!;I$Bh.2bSU4>1`A.&0Lo 9^]8ADR50@-[SP?-rUSF1@kbiISJ4H6Q#Q[WF5lX?q1!;O^rQ0bSK\+RHeg_I.3oq 9JA^%%Q<B%3O];g,Np>^LXU*0>O9l'e#W7_`Unht3o<cs97lD,EHM;>Pus1^,2pV@ `0g*\??Hj=LLU#d\1D4SN^?<M:WqRPi!lpX/u[Q<>[\0u\:gj2S%'Z%]QWtim#KY_ o+]K[_pgC/'CZ)[)rS33UQirP7hT5^;0tZqZ&&^PE\+F!K8K/car++":m2uBWMq.Z Ydu:,8*7:J"'91qF$\WY`fDQ!UqbrYiQ(ro@"ZLj`3O$C?5dCmZ:H.4]W'-/b_'UL ZNtnFp:?V7AW6'.0UE!Y`s/SRHe"n)>g+L:V[>Xp.m\Mb@"H),cg($G\_,<n?IOhZ /9+F-+CA0^&FP1S6XK>W\&u\W4mkBV?n6Kt2E74<fV'*:\;V"u->pB*6M9YS#MY\O 02f=-';c"[j*.TM!5F.LUM#QGW0pdZ(tZlY,DfUfDiAWE?jF^4_/^QKqP>;>`a>lZ bPJs"h,8gQp0^gtak76$`mc;4VX-M".\cX61,DB(=!P)[ZY2^23hjTJ&6^TPn"#B6 PZ20:1rk#$pDgOQigb=EIT>n^QjMB]QQMlK&Oh%`!Yju[Cn$'SW_e1$RNmP&SCpH_ Hr?NCKfAsY)U$30YOK;e4/T7D1m110DYr<2I?nb\(QG&fPK4*AO;D![eTscjWugTj 0tVl3<nE'%&9T'mrr@(23TlOr&0V=.4/!Cdqjo'<Ngpn3>R94VK[6J7H:og_h^@[user]1h[/user] P!9-I+*X:`3U\pOoYq.G;*rGGkIG3q&Y]+F,5`LAAaQa/iSTT0do]$sEj*sGElm0V #ub7QDX[Y6AWUO*(fgc@R>`?(`-<!XJ]]AT/NG?P1pr<?3.8H_36X/Z%IIZI<]4XU eI3mbWXTRY`1F/FH7dZPV+P)[mY4nD0$jGF-MM2B8[,fJo7fpk5MsMQ\'2u@qNbfU $MOJ*U4*&?dCsKn[',/kOC71Ep0Q@A;%sY$s8-JRS=u[/0f)_%>"4dP19l[E9$&i@ U/o*/W8,8pIKcZ+"=gOmNCajC=5X/gDB95:#*9sNF0gkmDX;6L.aQ2A2,m-^/:!gu !jmRV$Et(\Qsl[."9"`<qVaHu)kTBfGnt_Z;s5/BU1^,e:J*ejbD*X(?o(nI!HK6T e$H=MX@07]i=Mt;gQsHcrG[o&,ktrORHsAMXU]7C5BIr,fqd26CQ)Y(2'f_J)<,Dn q$lTc1=CApnFdt(1cG%4e=qtRT+_Pl_asQLN622]n)X?E1%,Z:5_kd!k4]^Sb+*2a D>ajmXr`iWMK@!qjttOZUJo^Ae>dL\8(CJJe"n-,nnUQl%TfUOV[<g$70<cM"ZoNA oYZ?=ok.@>o\uau_C\Zc\)2mh2$dLgnY%V\<lRa9n;@[user]l_[/user]<0%)`;698,T@>+[J'+>' ,.MZRX)ai2aVURL\99)u=WY-=nH)SW7"H3SIhi=?9ECh(QY16q_$M%7a6[QT_?HFh :))?V<`3`I[/IQ*CdYtCc[`c#KBFd4Y.pTKZpdpH)Ud[:nXA6T*h5&rWGuS:!QTlM pG*4ClB:?oNE;+_o+:J*1q#SCk-&PD_9.)*XiKX?kPNp?et=(D"Efir`3;#sYbH5" /:p*=r04><o;[-5]XQ4<1pHX&.*ORb7Q[r@OeIY3Y*CNhS2f$WoqK`JFGB$ghXqE( LoB,a6F-k9gm`I"d9\A7aNFCnfEeXr*uZa#-jCL/Qc*)"5B!:QEuc2t1`c4NH!XEr <;?(MJ-mAp<[-MIn3>-`HV@C?*lhL./@VKl[[Z%TR5dT8[jp$If$m3;Fk,<6(.I8i +t,n@U!,2HG9/m0_9C\]cTLV(bjZ;LjKTh[:_C(S7DVKBe;C<8DR3PkS%^TU;.K;d %f?$l4+O!/ET@&Gn/o3/F3aOX^>I92nD\OK06YKu(Bhf,#=G-US"%X_'/8L+O`//M HDtn<)QqM;X"T@BKu8.:L2<8d3OrE7r/2;:a;TnG%<o^$Vucj,CVUGdG_I!s7UdiM @[user]i[/user]&:ceSp3o-Yo*Jc6C[Nn3_s0W$!<`T/mL$^b9+6SsHT(,IaM[lJ;NbrnJIPVIX!R &ne;S9G47t*Q5Mf-V9i6'+Q53rI=ctk#U`ukfA8g"3c%1V$ub-DEF#bkEL>_.ff/l JGC!.nP2ZF^VaFCCUF\?pG43:m]'Wo;9>fW8N#eHFJc&!i;N9,>N7SucPbW$b*#j$ W('bjfb:/N3?Qd";&F/9DG,Zt3b4$#6K1Ec9'.+,VM8*f"IhE2@6mtT?e9bYhJ3p7 p0A7inT;_>>lRPjZE\H#@[user]Kt[/user]"0d^=J:)3@obD#5;T[WTV9W2k:p'%EEH('8Vj%-l@G lC.e=c*#4cW1&SOmPY<(gIBcAB?WpYYG?!9^bN0>-U=3/<8K\[`^s`O-Pp]&+\Ig& YYV)e%qQur^.O:7l6(r8+[MR?;tb6Ng:LH_,E\O+p@<401W8XT.C-GT/%"?Y^kir^ r0S*WYX/r"2pUmApmL&GgMqucmMkdr1IaQTS'Jd>Qh7_61n9iufEQjrJ!SWS"UuWf )[IMgjrO]C=,Kc!0tAE]!TAMu#d9Et?c]:to-Xh$fueL@d+iFh+oDopHuEG*Sc]6? (?%PrK^a]hI>U`9&]-1>,CH4iFq=q/#Y]['"5:^(GL=(5NZ<1S/W>/BP0TPd:!eF4 ;8&?`Xk&W0)NbbpMQZ*7/H2o<RK\VA07=<0'#1__Bgr0">YD$Z7=Q=M\I%Z09a4-K d!f`P28O`4b+1C96!ij*[@,bII\Fp?_B3js+:JUM?CLWnNDH5TbfI`\cgDb94IsFi G7_nn*8i.:(KL2";2eV1)Aut5ktJ4_WpqpMs$XK;rd_&lVe?8-*s)*(#50!T)R-so fT43GoQ3<NF`&OTENG]VDbr[3SLD_e$.36=1lgcHR%`"&!2@DV]S5Ld/Yj[<:76PB <XK692p,/W7+baD%%KYV.8^:6a\4b5r%:^C<Z7Ze+UsBMZksC8qfk&[O:?t(cj<.? ffFII)6^hgH'ntAp8d;6V;W(%"X>I31&4`MM?6)uE8=aEf<VNtE2c9[l:>!>f]SQ+ %rX#kAX+b_^TmL$5TOT]R%'jG'kiN2,&t`/$Mo*IWZ_bbJ@FN<Qj.l9eb-&06Q^lW Aq*<#90CTh5Gc.seQrN,W`OZH>G8-4JmRt,*qX\Ip-]g\f#1+*E1k6d7N/X<4cpPu Q08536"r<QLPaJ!Lo%Jp05]O*#Eg.Gr>4_;F7HVK.s'^Wp=Ar[#<h(M77E7s_cO`V m&a2fR2TtsCA=R8-GqR7hNFL@aYW)rj\mN_DnY%9C,bu>3qS2bJu\++Nl:<F)c,l3 i`GTN4\LXtLM>E.*b(&G8%+M&gF5ui)#a9+gZp$ASB^NafLa["^7`]%3D^VS&&4"" ^UZJma#]5Y1.Dm2#5`),b/Wu/%rWmaL+Yp.=-[)A<4eX9(ugJ1Rj;(Ls*-"^foa@R ZZ%`5ImpQ\0/$JB-L!PK*NB./c0F]=,ep8*<QBU1?LeSN..M9O;c,-*#,Zq,M8X.5 Uu'5bEXep"->s_G'77qQ=FGQ'<3ZVSFT(ot_HhR-?(2'sHFBs3Z6`Y]IZLM346ZG8 I"#FKB56o'@[user]gQo`FsO[/user]'H50u32s,lS2HM@,%EFtlSZmMP&XjPpGXf-efc)JnPa>R1B Q%b1M:hX[dXZ'53>4Z%]L\4W7fjEr!ope',d/*K%PHT:>@[user]qnq[/user].h$rZn'NE[#oO\lk o+)Pr=S),ANOk/:nm\UVcWP^aBk1uPGtf"PAG?3Oke`2Ii0lWJ#70bO.H'iSA]Ei- HD'8%I?A2.B!ER+f5b%SZ'dOcA%Rj23B>\@/6fc!Bp-sa.Yl<+Zc)&Hil36W%2qWK iDQDi9>eT7F&P_!*ABOi62sJ7Uuh'kc-B<d?Cqo,U,og-So\j$r(;:7Jb1$/ZJ@PD <VBoX,#U0jC-*G)#)UNO()fL3d$!@[user]p6hOj[/user]+3#P?-2B.goa!jr_l>`KaT'_P0]Im3F $?)DD^mrN>"'"&p(p-4F`53e).[]QhE,KJ><-15-^U.rua94k`bVA";<1TO'@[user]rK[/user])\ .8i@$,(pG\9SX?h+2sHLSeCTha7l0$"^\!rC`/:SV1Uam+\oFO6bQ+!:J)?[PU\^] 9UFJ:D80lP[Y(8!:d97'NABAc^&uK$Z+PBg$\`hm=_OD5pf.OnD!#t.MjGT8Jt86H E-S^.Gb<ibH/tRaF6aj?h&l9U$glm=1;O`fIql^W$i8UM.SAF]".#$bikKuSZ<]sJ Pl+Hjl`pK=46WI=?Y(j%p`Q\+%+.AYWlK4;l!dr2Rr_$Yhr7d`qWhkA;=?h?d8jY/ 5K`/5,(J*>a#BUU!X3R#f;X#WdKe*YD"PPG'k4!hA=+cnG&`uF`_X)9h#WLXLa*h= V#+\]$]iTQMt#NTZ)Q(*hcL-P@,VhD\=J5abOH)S(C`eq6cI8>f(3.-$DiGGm;Z.< af#eK<IXf0Ne+UQhn&as)p`C?*'D]"8b!T54XW:>_7X,\I\782oig[=XK9MU!g,'A frB'-I^@"^c\oQ[_huOF@0:c!J7&tke7'`-F[=JZMWa!'fX/bnrq>lZo.4K`D61uj UV%bVI19e`0(ESFMBB+X?cVLKWnHdu;f^%)0p?\D"n)m;=6DFtW;'`i^BiH>Mt-+S U).`pDZ!^\<k[0OH!F+2r'RXE1EaKfM;Wkb#_Z9p5lJVdSV=W]r9)B6mIZ1'n:6I[ +bL!hEe\'jp]hXNrS!:HffIe>L!(NDN/b&GO>BMHlRX^uI"Ch4Fr5an_cLQM&\k#c 9qb^ag7S`h9*2rI&$*Gn\a(.00Bm$ie^SlbENLU-cWXI7>9#!G9rA67(9;=qIDJoB Vj2.j<(4Uf"AsG7+Fte'6:,#Ic+Q%pO;m7<,U/<]n-,e/^@[user]J[/user];&J=W1`cBkqVBBNr( O+4P"@='sqHgXU)5hantPQ-j(p\T@0qu/brOUAdJ6MeDR0-*6+;<c6n5;:ro!#&?5 cKFc&53$3K>-TLq"0r56SA1I_V"'H<FX2nm0_cQo$2m\p=d]:t)2S$/2%Pm<Ut>5B =\kWbqp8bi$hkCho,W(1MffOc%7HQME+P)2<JIFX;NY=<k86^[m)EJ<_F18p8R)3P ?Yh6"V,"f@l]o"Lp/3trXCf\!Sf+=f_T:Pp'fo@&(PWHp6%'9'fC\"8]u/N`#44*N d\JB%3>dR)GJr(F"P\+b?2J@L7ZeNm8cGI4-:osC1LY)QFt!>\j(7Hdl*3>r1&$ds Wg!RgLjTPYdS)K35LUlOg)ZXSe]:7A(`!S7M?YBT0UMu5`E&\W6D\<!CII64=G5g` hjU/E?PlhTZMY4BT4l(*C-U<MIF-q3p$&dXo&=6+(#-m*<$1&;^Fn1g\#U?I?gT7c hEFQ&RNaO.L(>`D*-=5He+#3(a"lb2>U4B"NnBdb]?C[#gP:&eOnn.KaF%c$AfEBZ 'n^G?bG_8eammf9BT$Ochbn[9O(oZLYJprH9ASV0_3R-#-s#`%^q&F(#/6q`[&E[H <U5s]%h@;TN.TsnoWB^p+&'C!_]9QMFauOK9S,Y#qW\$-f7o]F@mp;f_+fso=!5=^ "C*iZ0RD=]-c1u'dZeu*r!sF1`*JLV-/lo=3okIsaH>ZaV"uXsU%MQnF(Q!,fHdRN /E`9UF8^9s&OUu\A!;"D526^HC+pbP[a63o4&t$og3S;;1^cJu5X,)qkX1r'n"VaM gc9]le\h8lS&L/pZhVm'M[tQaLS$`eo-\tEVEK;emmG%;HuGNWM0p`+L#i0Q/D<iG gTO/h5D_LKqZ.I.5024a3'3N\F/P_g$<ig\'EdJdmXlrHU.D.($MYgRjql%-<Ra$^ ,!OjUS4#g$C2J(ODHFXAe">"JQ<I)sc^RhN,b>!?ak]kkFcj7$?Us&tRlA];YY!DN 1WY<&oHH&0oogL)$N_3u(GtVa(W>N]&(8WsK&l?t"To4N56i)$PGa!8=,F%5>Ekf8 P:&;7>pKnM#uLl"cRFsAke/4:bR/NNg9f/=*+$q54_(R[E*M$*fJ0M:]MLqkJJ"=h '=F&dZ>+?4;r'9>a-t`+\lRK+b)<[\P'(`8(lf.aHkBV\71nPph;Ztg_RXIBMW7]K ?Y@WY,@[user]EP[/user],5nEb)UOfQ$mk1WhGlM6S-e^DZb3o0?]t-J,es0uBZ.!ujn*j?\8ul]e C>@[user]Mf[/user]"\nRU*BT1.F*r<7/pX]#'K3Z1Gb3#,O+hs0$TSt#/N[Pnn!&6X;fUaHs8SgW c11Ld%>2CWm'M8n['.#%9/*MupL#PD.[P#sVoi:#1DkF_::qFhfb>/1T,[_9#;Ydl "!_eEjY>9ug@r._?AUZmN+OpRI]>lX=5:[?jSh%*,]8Ire=1^KdrW3tGf9Aaa8<e5 I>hV=?MoOe8"i<7E#ktURerI5CB"N.jM@0VUboohh?Oi*(-?R>6Ck#7r-Y'iIE#]k eVLRrKY,1V5AQG/Y$2[]_D2^.=M",)Ir1S"?"=*EUe9Rjr+5"Z>P7RcE.6\&De85t Zd0P_\k1,p6IS+9$$M,PEdM+hI'DO56K0_e*"H:sJYi%k36V(<*hGP(??91!F_&7i 9ugU%kfTXXok$8#f$uBn\PA?e:*R^HTUX\JhGEbYY1[!?;G^B1*^!RgKK4g)rS<W! !_/juZe8T?'Fkgu\K+57%]$?1Y0D(p.D2TN0/b&/O5P>hk.2mB:rpH6U32>N`B95! d*67!LP_(23)9iZo:q<"oL50%U3E*Yd!"%-\,%]4e7%VRh+<eQ-5%btQ=aH3Bc2I9 7YQI#%`C8aE)uK$;`FS`(o!\T6[.0ulP@%@[user]1M[/user]"*4KAW0N,Ocd!S`_T!U_M=[T7n@= GO1o;<^5&&Zs'[A"pNnc,/.1lS*ZU)^P3m2nP4LhSD'fe'//5e:G6[cf]oX)M\nBh lT?fASTN#a(M,lU3-CG266MKrPl"o'n'kgOG1%d"=gV4`/fVHfXLqq(ol:qo<lFP5 A\n2U>J5d/pFJU_>0r$`BPsV1(]j%r"AWX\j[9jgkF`)?^l%t]<E@H]15MjIbL</> JfAuf:]r`o1<>'`+&<=::!>Om(dc&L*X/a)RO`Us9G1/U^]_ke!X]PG"kg'j$*N@t 81kU<QH1S84]bHa*A!jAU'DDE@<(lakXQnC8s<Ci/lF<^[$*\N9N&#JAKVO0GS#ho 6*L@p.C?%QK*O]'COc_ZrD2;:&nL]:H!2ALbWZf$A_42*N27cW%)l,6XpE$Fb/Z7` (s=n1A4!9f8SefPm0]`]J<7n^(t#h;o5lI3aI>B\XD'BpWC3U:5cJjZ;E5HEURFeP _,LaU7D[d$</+*Hq8@GrFB!W]9[q-.*([ol&/NhS'X1RM])@[user]Yo[/user];2&$79`/X_<C;W( SV:-DH@NJC8)emcB9I2g3-/[?NrV+'('@[user]Jp58kL[/user];___ur*p8*-k/]?,'^:qb2\-)r %X^L058]hi_[0aiOK^b9!Bl\UVEtM:5_j5XkeJ$jbpaYd)7T+FoD2/9\Qs@XRrCk& -6+g\-fX%RTMM)aR7sFG%?<F?doMD9UL8h4kJmW:<sX-c$!D(>1>4#.c16:%C#=8m ],E=WW$'GL-V3_g$A:-5A*pOi_5>u45<;!GLu$EUM14?FT+54QJm7siSMff)a5JgZ .c4<:aMr%:(nS&Rf;*.:/!LKb/]CUHgV@SO1)74QWpuFoPhXUEm,fq)U\kS7#;mJE r@QoG@Ar.jHs[`2o\d16n+=0'XC#X#[.S;$(f^X?bL@?n<@[user]l[/user],ABI\,q9lE2CAg=,@ h=-?pBuX`QWY4MacdN7(,9pi_cc0,0kIBdF`8>5:D#,gRAK'<&G(sE^oZ$=GZDb>k YpGl)LFK&*Qr-K['I[]$''KHJOp3<G86?:']uI[TGe*SF?LM*Aip9FWSqSa)!Aa#+ =]bm*<(mO^V3TaV4[o\+Sms-5#]!H5\,G@$htN`:I6LseQ">Bcm00pDSN4T.4lW^W UKKs^`fDj"UHeqbDm.!:'!]fIg[HI#O-e$h>6SsYYI"Mk)VX@l%6,Ms6FMRE]SAn+ A+&[#7["4D&6;GuBJ_%uR_Y-7a=R.7LB`c.LSoU72Feu$ZX25%%N[rn,AXgtR:%64 +)c^FPn^u8bE5^5#=r>-E!!`.nrgluBcK+'co=*FK4Ja[X_;Rlg]R?&H\660XDK:F (/5FJe>sZqgU!M1Hu2+-SS-8f55-k//QKW_(QnEmQ]^tIpqQALpufWTT8LP$mD\S0 gMoW7:9!2YG^`CT?5Qa2?HtYnGQ.&4Ie9,iX018@hLA\8/+tU;7XVh\qa/?5ZVImZ *6?*m:-E.`6)Ya.4Mh(Y.Q<-+3ju]>=D1UGb4;TsfQCbp9eu_*XnU;AU2(O)8l)!? q&FYB_)LQF"\"_<]!XnEPrG,RI"e-;Sn#;`,[k+t2#3hW?J-MQ5F],Y0jc!rbI&D- 9qHnofaS@AWZA$7=%1>-[qpFAg-P*BIW<]s].N0FrD?X[GJF$^o,sYXK]=U#kH%la L!'N$m<:/6NSl$W-U%lCXd0"dG(g7AL&#4q]#ZEWai[8gh$6&>GJDasRqpu8&)\(@ O`EW8FEJRNk];EgJ70;"N%.5+CS]J&pU[.D=o0ddO7f^E1JTEcP2*021pnQ7)@[user]4oQ[/user] (tMM^msgj!C-U=P:)?*_A1',e\D5$\ZI($Lnn`'Njc;HlB[e>V(8V@hb:$\2'n3$# NnE$>T4r0;"P849o\m4,,b1f]^CULF%0`^Olqc6Nn*<oq;HPo6Gk,&?7O:r)7VQRi U'O-+,8@OBIuPAOPMXUoYkQt'n[#WSp:uOSAaaO2B:+7"J=]bqc&0#D5S;Y/(`3]6 _]+)+Y,BiIc]ucgR<$LTB#U=VD/Y2b!M:``BlIMC<Bnlk5uiaKF"I)"BHVGVKgB]s 78,ffmP@t\F)k9sB^"N,)u$3RZau#'E%(-Y'60Z.T_5HFlr&RlZK,G(UHgo7<\Ok( Q,Yf%-&dd`0i"+,4:(P9pn+-Pf,4iQZed*9&T8RXVQ6)#%Nk?b'F"?g=5PW98&`qW [n/(XN_EM<Qa;E@'ADBjLnSpu*B>EbJdauKE6*\fV1VX%iABBmq5OQLTjPWFhK!AC rUmugr\j"U%J3YlX8=@[user]JAift[/user].V`2JsR6dGcVZ:9^58kp0IsUXkMRZlQ6aeE4>4S>h jF*.C]6'#Z^Qo86/e4e7%8f\_#)0%p]dSmFQqE<n9'cj6g%c&Ae1b8?k7E$hT1B1; 9JR!?MrhH6/Z:r%i-,<f#N`i1[-`<&1@.kFLVM:S_W>RU="sIJft^).Hh[<I7&]jp 8/)=M%ma2>":$U7lQ^a@'buNZc]i?EnU5;@[user]jhrfG6[/user]%&*d&'a_G;:]5KVR>E:pFn)8 Y7l'te<@,cN[W=c_Kn](M21Gn>Gq:L[Q)M-T%N92HHKQ#31kYgcr7?2*79!i:uaQo 4>1Tb1!_\J2;WT+k8Opg;`-j<>l^./fh`!i4'9?\^$TM?:OcLR:Q"7q[GH(V[jZLF IK$?f@@@[user]P^_Ic`O5r5n82jb[/user]*/G4i(V&&+VG_+YK5VnB6e!<#J"<2<Q+.u)r6CM7=L .%f'-[6hPUe8#_5J<jqL\g5!(KdYZ#bfOM03t70_'J7U&O/U=T'(!sb;WO(s[OY`l EenG:lNG[H>N1t:`g6U?R)mmQlkIt8s"d<o4%mEu1^?sp=cU!!_B]<.M%um^"Ysj= aGAbCRP<1P*Q:@[user]A3HBZ_[/user];a<p](jpT0Oj5P:>]N?u3dYX&3bJm_WIS7T/o^//U.OO1 KLBjq]&nU&?e]$G2iA43'F'EPk9(FphOAc1Qek@,<"(RP9fr!N'ob.fJ$nM12<;aC POfT$Y"W&O5jPJbr_&t)'.:Un9Ac3GhmrM8&XW^`<]^J-[09<tJ;`9m<%7WlUBM`j +/kl8YSQ";l,HQ'\(BO#^;1h;$R,"$30A7RH$[#nofV+:,;&c/J02.3X?ZCffrnbT >Ik9(JPnH8cBsd"Cob4JV>>,.^`p#L!DmCUZftqR05$O5_%rFrqDef32q1m#Yjn.( :4'269CQ4WYYcAH*jUJK5&`Z"-LmoK02W-$p4k(bQPuVbDD`A'K9I,]p?CZU%3D)@ .g@^9F'c>k*jZL8V>f#4U,_f>&2R^/1?-%nMLllYq2&fkSk>.QZf-9k4`s+]Yr'm, EPE<cJR<d42Qrg?>Dj?4P*$o\/i5%PoCf>jYH0luj3q#!p+G<hH`dqVfYCp2Lus?R j'SP]e#cq+K`=M@QAkul1iI:6bM4$UrepohR;Til/B<;m*lP@L*7<-W<n*%C_?4$W A(c^k:J$5?84G%,L1F+'MIdnIbcOI85%SIe,+lneG[9BMj1;m$$)6OHE%[Y7Gsd<c ]!J6m?8"hSPJ79:=&Zk^Wh[A.1="X0FOX\=Q+JH?j/t2f,i0D$@[user]LXM[/user]%m>j2ig+/V7 98&@[user]NFs9[/user]#kF\^/.8^s57;NE4^`)R=m4.VqNh%i1S!?BD`65N0:[_Z<2kRt.P0#BnJ (R7ZU>#OUG#P"BDq>a,0c<_G(eHXd!D<;nQ6t;Di^P5-,+lh3#A7lS@8i)'j[2`'" km5n7Y<(d(%qQkANa*tS6KfJ4o*u=;V>dm?XFQ%7:`q8Rho(!(g,q6a8J_4Mr8En5 +.&3[g;8%ETp\Tf"*3m)$??#;nSV'7-@=>Rm<0<&m9LNs8L/9))F,V[4][^a"Ua$> E%)G2>b+/.e/9`^BX&PEQq"W%LG)*YWGF\S!k5W`*k25/&\,Pur=RQaZYd;]DG:Tr bp[O\!ZWIJb_2[Q!1c\kA*JnCSP('5f@fl^H]:1cc=$78]R".2XhV5lK.XRJ5Vod" @[user]JINcAD[/user]![:#!fb(jWS=l78b/YH.#l5m4d.]]1Wn=TtK/jRl\kLc:''mdn3(WYA#OJ K69Esg=hPg,BOV:9E@b9"A$$>-R9ioPDa?NI!iELc0*a"a`3gR'&0[TfFBV=8@Sdj 80EJL!<TVCBNLoO'i"VRDNhfA+-ZC=)[_e;C%M/H3^-&_^>JfMmpiSf=2J)X/F-cu X=N*lk+Ir@m68"2Q#HE07i&V>%IZ>`=bSbL-(K0>0,!T`9Oc5b%e?=;g[&DI=jmaD Mj19ub:;.lcW4KcLTTJ%E+SFA40%6)(I.1&kSRk`12Z)>G(^&a@=)1tq`q$L/Abe: \h],9?BdPo8cGKW*^Gkn@dQb/k<Au9L",6!L8*b:AhCk28_uJtY8E"dA*A[gicun5 Rol(LE'Z87R%!,<c5X.m1^%m7OWa6eR.XJ5iXJ]je)6,F>IGs0Tjs5*2aKJQ)Zk;? BbQ+t=;,DC?'to68ngGANNbK\gL3!6LWeT4Z)pt?)@[user]0[/user]#B5sJJ"%d_(+deOASAt9)a ALA2.Nik+r#^qXo`LZ/r>^\r[GF!'A"I^^n'QuW/[iNX!+Q)aP(q9a7;WBo=_+#;I 4GSP0W(Gs+<2,538JB:3$lP3Tf'*PA*rV;GQ6(rDcA5^a*"I#fI!`o'D6;uh(l?N9 G4fqdHC@\fQFH%]oo_3/[7Q-phAo'a0IdsWKu00T0U?f?P</N@rB]k=VsV*/_0]Rd FP(j5OSVc`r&L8VdoInUQ"krVckfd`#%gY_h]AZ>U.C9>)>,N8Br)b/_Vqj`/_P(L SFMMR78BhU2r=5c!g%r#'4@5s+_V=EC$5aHC7Q(g2=OMCPM?E[ECG:Ahg)#^QhD%5 KUZ%N"^1jsc5/rrSKh=#cbK48&#Hh6K.8I1H!1\2TU9An<HU&+MYSeA'MA4\68IZg 6aukFI?]\aPW,$"]$,e@@"a_kSCV32/&d`kkdp#p!o8MURS<P"bdFZP$I[D]#gL5. akZ,Ri1b>J>FS[^0%ltt%h4>>r",*`#'nj5;K#?^Tg<'Gm=[&-JanAZ?p)"%?;#jC 9S-.5Dnn?pl4LnjJ\b2\EfqATHd9S:ZPN)1b>n#0.6'osa`G?oJa43;p^deOSS\'J $E,ZkKp,!R`8&\9,\#)!-&WTALINLb8<fiM>:=XCnecDdYHLMd[V?\j-<3K'[W(+f OU&&dA+[QV9>lE.N&o?$^P2EY"69W'P\7f%N+#uD0/CUlImUT<(Iu^55!>>]cSM0r ^4@q4(#6"]T`AOIj`Da$!DIT6e(WZln)UZNQ>J-O#@[user]`[/user]+F'4;m6)?iaW[6h([j95=@ p-KIl1SB-ok.H<"mWd&*=2FXHYE"8&=>a67\mhelBj.&U%^m[[Mj#kRMQVagj?$*4 W>:qH\d<p,FI_S($>1e0JOL%5$:?,R9t*L'$]TgUJMaaGaLL\:q-`'(naOisq>#o: XiePtdfT[?oa9RH_;\nbWNGK,$hi35'WWHG;=*lDWBX(,2grBVd6j&%Lq2]G.834s JkZQ:`R]"\W3PQG%Gd"P^#'DZYl:j:CUFF;YBbA'BKS37lY/@W&inTs#Og:HbWoG> 5?!+p%Fo^*c![K2BG2l1*K)ecr*`;fdoj\[0t;K).qoUOA/C;"O)GMAMJ>fM.Kjr# )kp+@&)B0h%/q*Goa,5`46L4kN/XI-=7beS,`Ah`J`e:oF=B#QU$rGeD'07C"#He) ^HH7M>?g<W]m4s^M`'KRa$ZJ+r@=7h`YmMt2PSrF"EgIYH(Eb7%e>!(a.("-%QkR/ ZbajWYRE%Z$Upl="Kr_'&8^eR-]ZXR#jDr(gXYI#^!9D2-R\['29a$<85n.YU[!s7 &4Or@8doFZ.V4((>Gi6heTp=/!b[LG.><'q,Q!9t'uB?G6ec;PWVoaO)!0dE6>5Ol `0e)=93#KkX(b72\PcY.Bf.^TS_]@=DXiAW)2pJ<OGlk!ih^VV\A#@#p;A\"J)H=p dFL#/laU]2Xu!%2Qa*d_6[=UEcZQHtFMcR<4(W.\0U3JK:OC%:j8;#CD;QM9rD`GJ Fr-(QV>b-!F>&s6nXKlb>qF]D$+//N5'K`C(m$A,f8Jb>`Z^+]A(*XE$`,K1^?UFC ReLqCXgc.$*!lK<kT@?$pBcepb=PmG_bQN8Zn$HrWrIq9T'["0CI.[78&^Hll`<J] ARA&0S@PVVdtB2Gl$ofp]2?O=R@cP4ZJm.SO"Cqoc4*A+7E+L`<?+[#F7Y#[_0r<J "1:aV,kZ;7+*ZT$';#4mdX"bgo57R:]\1cZ*I0(_c;\1jQ7/^?8W%6nnXjS-.^Ys2 iT!Fk_GWs6)0RKf!OIlnSf1pQFVEuUVAFk28D+*>ZHI@D=-QGW+3NH2PWk.2?.'(2 /.Km=J/*3"*-p-3$M`=W?HD!t"VIZloI4C.^#HcgA\daiHF:J5O'K<%2HSqhH$t5r 0Z/Cp'D$[P+>X^b[H?(R26GF!^Gs4R6YoH[o6'XZ7m#8\j9Zp[`<YTmEfc:fdH(%h fW:UA=Z%b\r)0\%;5_ccoXkb!">g"cq0r=d6Y(q7+DO+XU03AK36\?TJLb#o0tr_6 \%Ei,6e^F%5[)oE$TVLXJMr418XDo965su;X?.emnM#0UpuYj2DJGmtE`Xi?6a]6u fP`@[user]JC[/user]*1m^FnVu-&%!Br^O#N.@[user]D[/user][@[user]5_s[/user])2P]7j!m`M-4ff.9bC(u6b9GWS"oEm4NN -S!&fTJu#CDCX&d.kt*gS5ZajDH,U#D>=&nYggrHRAsM8-]<7/Y%$<U)*Q"LPnL?l -*p)mB+/I;/7<YS`NrX4^dSp+_hl/d#+`I!.>.FWR#oN4ng0;i#!V]Di32TgB'aW. b3"T^`Y!a08"P0:Y:no"F*81JPI7/ANUK3!Wj*[:p2%i88MAPc2U4CCVbS"ERi+0F N`mZ%=8pRDET5J(XXA;ZNml]V*:RfT%*%E`?k.71:37[oV-WJk,bu.t!CB*Y&;^4f !S[bdM=%[W:1K`idlN\?8S:)Tl#a5.00S0W^jooNl1D:tk5@Hhs*@[user]]j[/user]'d=LE3&4cA KeoY*cYRM^;Va*#q+.n\TP3I4Q'On.#,il``8<OemkLNoel'6/mI8M#icg.O*8U$: )fTnfmV!^o1eYILl7Pc&Vp82@iK2]E'A:ql^7p\A&!10<XQU`5%a%[Y2cnhbS;9fN J8Nl4VUaW[K*IP9>OI@lW!*t47"V&upWd6m$gn2=eDjk6jmBR[@#H5$6dh$`DDp?d XVSC60qmB:n5)X[fjW3kDpe*hI0:iQj]9+\W<.UqR;%ie[p';2*Nk%&om4_D9R]95 TTPp+Y(=/R@p>:7Z@rqq_\Xp@jCREEj\ASD&!(0AIf&&!/fd(EMk4W#-Hglr2cY6# ehAK1IP)InVc"r%6ha2&]k*AKYDBu6JW_bbq\O\*f.k:bd!t4bC8++4PFQWLgAbRQ kV/pkN,&\oT_k>E)HS=,<i?@[user]_kq[/user]!_uP:>WFfImI6:527?K/dTT#Dl;t&!oi^"sc@G HR>?s"l^##!M4#+A<_2<]c^2k%(5^H7L[2a1i_Dfa@M(VWq)9DkdLAU'sh-qB!#%0 IXfHl9Uf\9WTDCYD-f*camnsZCF5`4K>'@[user]IA\iZD0sP[/user]=brf1-8Vl9K6F3GQs3busP 21H7YSACX1*I$c,2/<O"H5jG.`uS3/gmZq=([o8+l)K+gDbVH6c<K<j$B)FfdQ?IM n)-_dR:a2]+r?AlJY.I,NK!>743I3S;5;I[KpZk;iR$uf+PgY3P11$X0Ige<AX0IS W:;nN1H9+e$5;GR>_]@[user]4[/user]*mF*;[<EQZ1aOVEPoL(<1Lu/9M)6.B'bWS3_ISt"hMiqQ %:0D%MJ4?_ASZ+IZo-&fpmr=)Z>S)(VP>H@@[user]G37[/user].Eio87%dmmAEV\it*p9I!1tnN( pSW7IbYKUn\9h[*@%Xf5s,%hY$>+s?2Ted&^.!9;%r^#"=Wm[k)9g*GW)3a+9YW/Y J#LYG!l&,/d`>A$HQqm0?ms>M[:<4^dbpkcL*NGWZ(e]Yh!9nn'^-msTVTggCQFi[ jmSJ$iEpIK&Fb;0#5<Q"->A+IqdC&,Yt$CEidij$rf1*B]`Pb%#cGjK)JSXa)V\YI RCDpX;%QuApk!p[P"E<L"o:!QAEYNm\Q5rIP.bi]VsG((77f;=jLgTF]DL4eW8uGa PcTL0C>k%7>l4f'\u770.SpULq!A;#1Fh(h[.D\C_K]70$Y0>?f_`[nG[1+;fC7MW j3lt\W$1/o8JV\.VRk511jsF4BR2*CR]8qB;9:1S(%Lq['X`(p"-94@h27BgDQ8Oh MJbU,`Y&u0Ge$b_+VWh>_"3Kf[<:^mNtR+a8q/<r4e++Z!Wk;1r&d2eAb2OLFmu!^ 56lsD_@]K[4D9qo/qAHgpLbc7akF=Y+4#GQ$/Xd(PS3gP[#U(ee[:@[user]XBJu[/user]=<;>ha/ h!Y--P4MYD4gD'aMta`60Tm$u&=HKaj9kk>C$d4@Q6Bp9a;/CJBb<fUS?Y??HAWG- qe7qkOXG.0($1VXPqQ+Yn8]@[user]7[/user]:QT*!<^Nam[:6PPBq1F;E91W/g0Wc2XE&VKDDEUt *n?#'G\Ete:9:e9bLNYaOC]=!@Q@!8hFMfle=tRQd0Z\l#'b?46O?usq1D2p&o-k# dZ0.".g\%?A!sZ^(Q;_d<mHSm"'\#^o#p%A<=O01ol^udXs.phfNQrKT@LF"+gM>C kDTan^5)hL&1Q.;p5AsjS\$o!D1S>Z#8rf1(OSF7:GiiV"qq"uip_7-)a"dE[fn+j =!,u/f4a*b#<NTd@gFn%VB/1M4RtCn!DlU[!hP=bL#>_rDolUrC1g;^B<D5^9-92> e1'<*A&&uW(6?"+b^GID)'%WIGYLhn;'l70]Oi+1N0g'bGO!P+R/7RgDPMRGn1c!1 ,l\^#@$uUd7Xh:n6kusdA)WR_Z2eF(#k83ON&*-$bMOq%0u5g_Y)g)f0[<)U)1>?k =V=(^bG1lR;8=X%EZiZu&S0j\+Vu7p;<j0A(?p.2qA>,:`f^j8A3>ca"%rV3K.O-, ?H[X1NDu>V=d2^dHt1hRXF3pg5N^i=j?.oarBi9;G%S@j1<8MMLMSou7<DYYBk'#M 8L4]X/Tj793rru"Qtct!RN(GS#TfaMf25gYB@*$%S;J8-DU"h5f:YHG"rZGt5Pm4c L!?:a4ot?4ji,ke4X+4h![iJtrLS\TcYqB,-^NK%1saeJ^s1SG6EOS>`!hPEh"+&[ 3+*s\,Z:A\C_Q&id`S+>._TY7[17qJ1"\Rt`UCWH4V=RGE(s90_Q2eVq<`@[user]242[/user]+l+ Yg^C(].BiQ+A/g<Y(Q=&daDoHoLf7WgWYOCAtep<%4?(qiOLVlnF=b<puFJmL'D-# <GtpUDm)dO`[0?Lr(!GQNgF24lej@h=Bo<8CXln%^1l@HO`<80ON`1(Q!!GGLA:!f et_9'LQh9iYYJ8d/#&GpB>Wo,!#]a%K])LT`T`%`P[m'7_K@0oXO_Nq\Jr^8)Ct@N jm^$j<c#d%p^,M7bJV2\]%g2_3QMgMQm<7aBt.=mQ5Y@i,2a`h5W[H`4;QC,WWEQg G,!O8AVC(WUTP<YH/(7q\K_AoS6$Z6C:C59I66^)iqb:LF`i\P=EFhu$Ft!TE/gO+ 2MC6OXd`7g)a1q2Is\gWpH*0G2TVH#r)]TlI'2V[XeNY<Ze8i&LJq)+b>2Z8[uElC *DWNe=ZDX-RPT?hd$_8"ntaIWctF6lbPk9Yb]8Q3Ye-_cF=!aM=O77'h%bB=?`Cb7 =f/=Kb&rSl1+7&pFk'A!m5!1dGAE_[Oial]a=$BcVsd5+[mT!F6!XlO<uFhq'ktn7 &p8o5p:mDiHYcXD)9*'GE)('Qlc'NN4R@6UCMB2;0kb!JG,c;bUYHMP6LH:hgjIAk NoS'EF,o^/*8?RnM3k:&3.V^+:c2Jj(aNTp##&$p!`NOm@+)W#dV&2`g>6o;J28=r ["%,20CSYLchfi>:Fur&6Ue^MWi+;3#q4LB9a)"YPo)N5QI>&=Ng!-0Z'p(<_O7O> Q^S.R+]F3/C`23YleHI.:s53F5g?hpp!ISK^1FEl4mUM,1po3*Z-EV@4+(l8Y[81r Dt*IcqmF9"(250[X_?=*AhQpWoD9aO<ino<[l?fbm-4+>h[ZBWkb[3)X.?N%2C`_I iAf`Ks3-$_L"\Kr"5?,3H+n3F9W7sF[n:9(Xd#6fQ2##Y+[(u+rci?NG3\&Fbg@q. iF+HIN],9T\72V(h5dS/`,ih#K9r(RJ1lUCgo+lhmH.S9P72bUlWa&F.oZ[4Q6TEm hn4]GB,h?<;S>hD<3p8;(/r<oetp'driM;E@[)CDH7d71'/FgIfkko5<K(7u:M1Mc bXZMjX4!-eo8,]a)QpbU'/E@h%iBHc7t=aodHS0C4udVa00HYm>@[user]ph[/user].qbO9ictr!- R_8)\ZbF"3'DY`E`Ziukdg3U^C))hfMDP81-BLh,Oo71e-0p!,DAACi:6SLS%aQRa *Ie^m[#`P^1)M/u74Km,.-_FKfH,>=hXF;bXDURaP+!tRnL-h@WK9RQo<Vji&m6)o "[LP-+]KKWNN&$f`u=`K9E<<j,0BJ3b*3N>>fkMkS53aHMnd:D;K?9tcV%D\"fI!f SKtPniPdf]7=4-DIG89)ae?G\6J)'me+N*YqRlYOd1o%RqYqlsTkn2Bg3nd\ce<Qe jPqlWg9n28DS^7a`ARp;,Jk@C7Z05BXtX;T6@I6Wi!Ra/b+&saQQ[dO6W!cBS=,Rh `dZ!#+0)f@&_YPOU&_*Y=oJ_2!]d5kMl!IEUqR^,l/Hci\M7d`eqH!%.SXpuSs*]E 5!cT2I)nl,T9DL"j^\k^A?X\@#%/Cpa[[9^9CKdiE;%SBrtAU#7,-"@&LF\;OZ@"S /g\ho9>#ib=F4KD@VcolgbjUka'*!&kn\`Irk13)IT\\gK%J;D?SdHG/A*YM:`c18 $qi@AMg!3*j&"r!?YH<@[user]XDhbXrm2N7ZqQ_q[/user]<-sU$q=H7g78&4qpV_J$97C;,Ksp!+ FR3t3TOUo2[?O<qN81Hh;i)*TbfIrY%*0?O_)qLt!PRK_E)=5[[)jj?/8sH:0AOsu NR`.$nCAfIDCDfBhP-Bdi4sN1\)gjE)gA6nilupTK-GQp!/H$D0k"__-&!jpY6(E5 JNiKWYOqo^lSo'Wd<TsH:<IiL[$RBkq?7`WM&^F0[Hm?R"I\['q;(b&m\B5pGM\Ml H.dds%>?R7p.WZs`>Fq9P&3'R\_3Ill@UfBo-"cTR2sNuNoDY'guPONjJH?YUh`55 %>*@>]%Jk^2qHL,./!b/FUM<kbAHZ(Q;n$QmD;>!DX2SY!P,'j-+DjSC3keQZ^bs! *a6OU2)=SBCREd)BnN/KNrH*\/TONE\9gfoqh':bX[;K1<h6B/oTb"1FT-(Nea-kA 4n;^QUq@-dGk!uK7.!pDlFJVdno+cCcm]<_d5V/[[u<T5I(Z56k"luDTl)Dt&0(9h *EuUU/BPo>g+6u2D69k^9A=Bf'"p_73"5f5/Pl7DZ)tiVEJe;u(rg6h1Ju3eXt@d/ *Dgu59>2NE.4mt@EC$A?5A'Ai2Aq8A'^NAEBbI+bUldI#%323Po8Gd:b7sE9PFlg% NTqs&^OtbeGmDU>(.i9D4D\aQSD@ji*#?$.@;0@Mo%;Hqd;#K!fdMEY?6t,jNd8Pm TVcKi9s$N8%B8GS9cR1H5\)05A"*^Z/7H8Yd0#K0FDV\m"=Aa"*B0+e0Tl+j>hY-n PeT4$Fi@,ZOo.`m4E@&SOpc7S)4.#OkDc8[)&JC7fLWqd?!i5/\U8iO];JOJ'D'Op @[user]Q[/user](3dX$iBn0h^2CKtT04bb"tlT8aJi_fF0Sm]>l#"Z>Jc14bh9E8"f2<qF8r`Ld^? @[user]t[/user]%m_'rBA*4)r-2T>kndA<r`(JK"?S](qDYQA^off6P$%JjPZ'1,BQ&O-6+W:3bC? k;6LC\Z1;r.q;HPJ>h"d3K]8_lhTd<.t2S4m[!NpAK3C!=t\MWcuN7+k@$2@4OGkI (H`lr1-S0G>`S"HA5c'W*+6taD&=ilMa'W<SBWC!6(?B%$/ErfZ2Mhjnl%tg\uO34 C;%&V9+;o4r+2NJaRbnD?ene(Z8?[e5j@^qX<:jEQOb]Hl,ZJ`Cr^V'[to2X]iQMY R/BoIh3tsYJFuuk7#j`@;bAOqHN26FSLpVpYmnbF.OfI,6Z9'Y<6Ct.h&joi1Qg93 f%l++/@.[EHfJTVDZd%e2stGk&O_V=j$[oW-?Q)kigg+(>8I.3iA>Z<OpsTGJhG)A =?'%l4\i6@6?Jb^`oXKQfW#gDXpEn7%iWh^q_\V:`(:=(0Va-K2rN"-Du'M+2m[bC D<`_cT-Iq`NH<4BIdm@A<8sZ7WH?Z"2%]?.$RR&T[;eP(J36j!b]8PuSN285mN,RK gM*B7e1&OKI27t,-Yo3iBTJEllaHRl--b:$CX>W2H'.K9+Y31NAs1"O22i`&a4pM1 06I3IcEFLC3t+.Blu+;$eZU?S_0gsq9o$?H%sJk^@[user]k[/user]*8d)X$4L5Y9AJ?QMWBeFY#p J0Y3I%^+DONRdSFJXab0P/?AQAfQi"ET3`eoK%uLYc>83j7Zn!mfTCq]E!HVPReIJ mIHVTFFXn?CnTX*_C=oUmr\5&J#8+W^qQU6_$9D#aC[ID.a6kb$/QMtF;AeXa*SK< KpTp-"bq76]gQ)7#A2WK_lS<!n"]pn:O4trI$\s50G3cblo0W7?Bc;d:3.l]K[U\s 0AGIYQB/gK^<7,c&%X-=pid;Pl?Hb0Y[&U@I%:Ut@DU!@$:,O^44+bJH2SAjGLR\` ;cPcV;EkfQ.Yb`MjHnY=]@[user]V[/user]&'"9$T^A5gH/g&2]V2WnZ^0BXarcLTqDR'5)6W6R28 +NHX%QT?.JQ/-UB0d3KT0c=bj7SOfM7Y>\)U0L*h7_&eV\B?N!b?iM=cIlb0Qb/%] #V-H>">E\@"a$L+9Tu`A8Z/H5qEr`=RFltU%qk`fB3ALHORuo[Z^gc8hrf:!k:%"- O_-s-H%(9\?J""T8N"@[user]D[/user]>OL-GjM!0nXqCl=8'8C"L#YqRQEaTJ,-g7qQG\b`j@/U( 1-rJ$P-^&t*G/MB],Nq7%3r@D2W'+h$%G;nT!'7DMSqrGr002g,KXomGY%A2`dJ'F ?!^oZ)p0;8k(l]@[user]QQ8[/user]&7J9%/(.>WXpP_p;5?h&@[user]1YG[/user]/)qC)_WDC>I0uNMMmS?dF0g LKH\pIaYF,iaiPP8T\QN[?8d++L<]c?+W7DN)tr-@(E28];jH8@6Rbu>K^Z`'N#`\ 9:m2$1.C8q"AuBfU8MQj'bleb+-A`)&?V?%;8K.6&`\\!I>ABnQRp]iQE26X&Ee)/ 6<.OA=dcBhn<IdHUP7"'8p-FUn^-t-Sb=u1rH5?PB+tRG$[E@`F&]6;f,o/U1!.d+ UW8Op37\@[user]h[/user]<^.1"THCOZVaInS1&)omS*X1,O!''Z]ecMgA-Ffg0!I$6;3^+(&m]+B ).bkZ;:YC:TrK`$Wa3Vj)fDqTM=uEPge"4D)sp's1oT.%ls2`HX`_cPolqG5%joY< CSX8(bL'YM;j\%\<PJe`S6UsZc,g6Cl<tC1P$Wi8Ph(\+S43reTJEJf/uOW=G@`5D B5NuE`@[user][[/user],#r&-Y6k&8Iq-H9#N7ck/7[sAqtXf#$eobu`,s%Bk45D3Z#[(#:*=k+sD Y!_A'NTSMaG=c_U?=/r5$?:tSPg5][gfS:M'A,#A:?(uD<ud1I["N_ic`61nqV9ZJ j.D5]'gljY"Fl+\[n1T!f('8tN5VlY2@5hcHsp_)?\,4.Y*'QKa*[^V:$JON[,N(c hE"Sjq0e1Ucu6'WNVaa_k^RQ=:Qg`\b6@^aY8@GfFGbIoGN?r_hq@&H1?k&?:NC$O dnHt3j6r0FY"X[rPA9B4,MihnidEVR8M'XFim!i5WA+RE_o5`@[user]KN[/user]*<,UpnBfltkrL fN0t5dOfjhhmO9<Kj%WLP/RmmlB2h"</E#V?mP8cS&hp9V.Gqo*c$W>X*f1qe;BO7 #-P#s'0)dW<*%U_gT-R%:bIXjh0Ta+V[59sViuYf2iaE3562IH^RH<G%G5X4FL&'I p:Bc:][u+Q%lY'S[kTE\+YrJ\\D`QKI4(`[er;"r?H4*kBk8K__"V^@[user]Qh31mZL[/user]>E? W:GK-\&'=_3d@tVneP`62o6aiG,@[user]S[/user]!(@[user]Z`6[/user]/-<RX;E2&\?"'f/<r&ctGn.+W9KW&- `0f<kLgO=rL('"0*bH"AJ?)(Ap?a+K,9%,8+2#[UTP!dsBLp'cXDQKh47EVIPQ2>9 Ni$b!=7RTeX2^aj]jV(iSM.]DS`rgiqn!Ip8#"9V^Im0';a9\t_\1$"8!!l![`;%n %5/)780oj!?HWZJ5*-S8+>1uMaDCKqe&,f%#h.u^bV6nDQ8[?egYaO@A\7l(cRtPL Nf&A7^7mV;Suuo8fVQW\dU\rdcr^L+21M?-hHPQoEoaO.Jo"ocq3bao^<;X!M@8Eh a_>[sCu9^fs$LXTdBZtHI^cPMV]d9lDp9K4aYk3:W71RT@[^Auq^n7!*+O'Q3)V8Z FO$?+1XK?P]8@`8oEo6HJ:=48O7D2kLJLU%:Cbt14H!B^+M+8XKkEseQY)c(O1nFM #H%[br5_C20h8rI-,%=:2aS]]-s(fJOQmllKCWp3pN[Q1*UhQSc+@[user]9A]OU[/user]>KERJ#* IK(@[user]Mc6AHIbNO[/user])C?54'qUL]?PJfi+cE;F5p(Rb%?8'9uA5^<g#T\m13Ol"JENK6id nATk6kXM[jB6$t'd;'^qA#I#;)+G]gG[U/NO`Oc^2\]9=:rLPNW0E#\D),6V_D\O^ 4t)11WuR#r$)-Q8%]C'u=5*.a'1==MOjri,jf.K$Z?g8Fm$fbC9p/-<c\.eOQM;!j [rr3@1Jnq>'h9X:"g&RA;p)s;g>ibP%%>e@Dl83kdD-8nSNj3[+.l)O9"9iq;RoR0 Eemiirtls&8$+rq_4&BMiLK-R1=0P6e^6PmFQD!5H)V2&'M5`/T1T"=FFV3$CMFea O^V`c>^h\j'Ds:Op*XX)EIk+ir5krni#(P+3RVT5WbiaVJ*N6r$+JZ'Tp!+WUc&gt :((B0!t$MS5*&V`\Du81F73+gQ>k\.G:]*dhf)H_c)5e"I6GR0?XQ=n,*ONUCgn1" i?WRR][k1[$k<thTNcS%$[HN<%+ds2>jt\XT+-)BO5Hn@)R$6O/"7%8Yu`F0Djor" lH3S"3=k'`H/oda<=:EL&$9$KI<0)cLKd"?bGi<B_#)l-OW1bR^&1(JYeY&uJOI9P =X]A.EG]rNJHhN14)SNnQPFE%\=FCYaJalS/!AA?:9$32WP6A6cM$/rOT$*gJY%&% SIHcb_J1o*dTXL/0;P.Xm_+gZ!M"WiZs@4N&I$R:OT=k5B^%U@9abaF1TC&j9"3<% \h*2n\Zjf0Ak"/Zi,a,I:AWlc%YX:^1XJF_S(-oK*E<$0YCi;4LN']RoP:jj297)# a.]jc-(0k[*EtuWH/_/N/'W.iFKHC,.QXWAWiF6*(0Zkt3cM\Q7rkeK=6\qQ`bU!1 it:jh\o@5-.QeZIV.g!sP<bIue9[ma)5cf0ZKK@=YT,aH@WKEc-@+=`T&]Tc5Zc5& )QL4d;"&(ngSmWZFP<LD3P&m8ci#Ptn7Zd25ca62R_&pqj-E\?rT59.k_gKM)\DLR Mo<+9MnlBJRM!YOTlZ8Y5/(P0.YB#l\n%+?2oF;.9A[a[aJ(VaFNO""-'+)r9;Z33 d3Z\-G;T*7DC]=['kq*uQ1q[kT&,X0-F65kT;kNH$]=LS77FV4]LI[aW+DSG]eV"j =k=iJY-XKFc6YB5X4o,Y.utBnUlR1:V!1Ip_A^oJ/$>6aVbmmp@rU&D\_dROZ<Z?9 Ki&D%QU%-pS@]ms,SR/"11,<s"+4+1[*?pq2J#s>XMLeK7j72!!OVL]X0-V9O6q&R !UJ@7joZXK,H/q1\^\(d[q=20:Yu((j4,%^eTlmbio(lH`mdb,6?]73';K'A[Ah9T -:+_)'go"O6nShFa@-4tG.HLSATuIlZY.T:ZKuU;fEL>r&-TX6UOXVIe>?P^da[NW PI=&\PQ(C!I'i/8SR#X>bN/\k1[jqJchfiN-`3j3,b8/?Dtk6i^3:Jm/3gP$)D!"% 'C3nnZrS$o[V9/93Ik)I@ni8,CMiIF%`__GK7hGk4S9Hu<sh$QLYGF<bh8(0o7!1m -&d^(lJ@7;=7%-KUB8"[=5)s\mZqe$-4\FXk(\nn;>q7g;/V8>Z^`c<`A(maJ^17B f:td-T/.mGm4oj$bRPB?@[user]u[/user],_K#:'Z!!<n=iI!3="Km&Km9;Y?QMX:W=rWel9G4fe- CX-7mlB'`59gNZR:]'-j4)!oh=Q>])eRatr>5Wmt!mV?1c9"D95+6:1B+F%sq'`)' r-X_u5T/a?Eo28/D'lXWOXNS.PVocqIl^<8E"QV*7N<-`AXs+<:.$dK<j5Fr9E"Xj DQ2CCVe8]RW)O[3+c9%4lcd"&-qfT?;EeC"k+'#kdX;_%EM/:5"GIV3N=OP$J0q*S <K[F2=G3Y=;<T4W=DCB=GN)MAK'HpYTN2;c+)[cW>pL9CN\RN^9:1$[Ygic?3'Y97 Q%O1s*+9?(lor!FfCBJU\:'#B=`?RA1j#m]Y^s-:B%o>1@V.p81#t\"#qI=5[GVn2 V:/ce02@!bDDm-d9CQOW9m)gR/gVrL1X$$aThM.+gNU!+k:Q8LH@QTs=BE<[5Ls/o ?$[jLHa?SU2d<)n-NuS,VGMU>!MAfcrZDrEZc*=O&&ZQXL#D\fi[,]L5(,Wi2@^aP ,ktXQ^qVY\XS@3H6@+[.;oQ(f5bQ7nj_:-_>b,M*J@pf5g.Lah<G[Ldj8Pguc+CKG Eooc(=g;-Z*^orBC7K/nZ)'J6/:4(+d`T('N8!;XVi.lS;jD:Z*!LWPo^`cGMC(_: p_!&9]X,0-:BW\I6f1N?qUr2(RQ[,X'kBIjLdMQ+=?jK'n\U1@"i%S,b'us-pm"KO <]=PmX-@[user]INe^k[/user]S@G-11G&WbKY@TF?j.'DtZI5>\@[user]e[/user]<V+"40Mr%3-#nj_e6=C_>B>Q :d9Dl(\,*OI\q@43XJRA2`JOJ2c9J(@[user]b[/user](HZ<UXH3Uht3\^9l53WWD>n5WW:6X/kDQ 3DWpnj#Q^]n\]B22@MKm!3=?..QgDf3"<#dcjs?m^LU'c0SYJPEF@0'B$XK&+cML: lBT%K_CatC$\]qk_;_Isio6\F6N.*[88h(k>XB2lY/d`_61N8gMA$/Bk_fjl72c`p +Us$12/rSaM[Z^:N^Um9*(G1f6g$N'0(^!,U8.)`G,RlW+@[user]F[/user]>F*EY<lL0fn;n'j\" aXB9PiRC?F^bl9[4/&opHLC#n):4Ep->ZAZ)9'M=(1sV5kqC/EB0D<;@[user]Ui`[/user]#L58;O 9PBh`LuofQe#."`C]aHUTRR-G&]Wr_&Uk\V;^=!9/!F"s]S'R(kl*\YDl()S!:S*( Zrld:Fa1oZ;h1I#rJcpBAgBZ\n>^@[user]4qGFlf9D5Hn[/user]/1D=\DoSD!K[<t%[@[user]l2[/user]=eM<gp 8k?tl#%"^nPeJ5(!EJG><3=oNC3>Z=<RGAc7^T/Jl1.H$'M6X0Q&."k46<G`IOT`h d:ODPW>[eh\@[user]e[/user]"u_Q[HHbJe@^G7l&?<8gI<<")INr-.jn6^r1Rlm*F*d"\X45k\lE h7S<#G6Gu;1M%<&!V3OBrh:JmTV])t2BH]E>hICoeLAV3hp;Ea.ZuWqY@ealV!7&B ?*c1No!hpo)B-81U@2l2kGFP4ZODtc-*[OD)"$-/1HS_<RQ_RigMa<hqZ`OlNd)L, X%7QnbFe,Id1;%@[user]f[/user]*m/h_N5i6MjrZ9[[KhO<9kJ7mH*fD;jWjQr#M/RD'iB"KDIib ohQi8eJ2nrdons?_:iDcKj_#O7M;e\+]q+U]I$1eX3$ipcVUf*YHG.RDpH(?rZoF< JTHr4B;a6C)m"r@=M'!B:3^gu+]r(p_<PmH%1oW/TLN:m:,SaO7DaA`-oHsN$!_E; "3kA0CT?]@[user]JXLI[/user]!Q#j37_+`j.+>K&jjQgAqMg&HNRi<jsNuT][d)S+bJWkM_U`O7o pp\`8'_n)je_\WgiCrHFb$Yq-5oPpkJ89FQ_7I@^.S][#L(hQ5b6:I&aanN92$*01 &T,]bUKKY>6(Nmdf5SO!E7MSkrpo:P!XWs;p3.O[nibG>f\ZkX?.\%V87Cs&!0r)" js)?l#)C\eI.Coob73$$l,lWDB@+'ZMH:0P1'P*O.)5S/P+0nrHkQVc'3'<+38kTK kk#A[qXmO&.ciTB!$EM_dg<ZZ_e8:,7FL8#lcZHRlMM%j?'e#+#/*\m2MM4;\?CE( 07!rI"bKS9ItJJ)f8H>H:;=SA&`cjh5qXItP!&l56JaK"hFks:Qa2k$Y9TBsDkYtR jAHnra"6%WgF5ArITiD=,99hhG]2uC\r3D5:0)5TBXq@#-$:1jGEfB(aDNjcCO=!7 :Jc[b>jBfpL#+m#(IXchjjbE+P%LppNY=>GUrbVHFm0b\0JZmeds+JAj&@[user]i3WGp2K[/user] Yha+a0,]Ff-=]+Z+gP=5D%Q1dT##3]c!%GoQ_EmSrqUiZrDmjsA^rctD#DGo#bFW2 ?.IAACNTu(ULmF7Ys@m6jNqu/[@%+4\;_jOGWDrWXn/T6YeUXT:4'1XVP:sn?CQ=' K1F<@"oc=H:pcaa_3rtsVm6PH^42BHi_c-I3.&p#9gOca0c@p3_EEEj"l:)X=%B:S ?AWF\OIU2RH-$C]J71lb;;ip:,X8"&B)+c8fP\0l?ZKDQ.K(:Y/k_T!(BRnl0_cr6 ^!<^<0]j_Bi:1b^DuCF@P0e%C-f6-'&FTp5>HYHW;WD/aJOV+]LpTo*L!*GZlj(p5 9ALn@Qdfg;/[%%*j3jT6r?a39mkL:gd'JQL'Upl-_<8.>CpG'HcQ3-L3,XoHTZc&l )_+E2i\Yq]!j+eE<2;&t1F*97#Hbj,Po*+.!'662.HG1e2f7`FX]s-0.oVt!3%#l0 VL''kVt2.9AsTsD>D4deEN:0HS?9,f&@[user]^CagnK[/user])4`L.3#R(.c.pel?XDr#i[]ma.9 -i_M?R0PZnSPd&9H.GX*1:.e$V+)Y&)G`7F,tV_tJX!UQ0j=kNAht,T#&Jp99CaQ* IdcPb/RB\'`k1=I@rMe-&/JcFYaE]i"Li)Y6^qL>"e&j\SZDJ\O+-gd=csr8,\^of s3p1\kFV.4hrR;Dil`N%N\cn>8RgO0h3spPC3Cd1\]-EOHs%#5Y$sL+K,X+0c+gM@ o*nr[OZc`E6lC(_*YX6)VTn$iF)#`2$7#gmV[RmoOBn$H,0-o8=HV9DgI_i@$\B(4 q@t^fXMdj`id$J,jc``>MEGXM=`30>iL_[SYV%t_0^b-#:S/TTr-lp%kPk%KL_m6X TJZMr6*%#Z5/UR+lM/$O5_5fDUr&opG`e$!THY0?/&<HZs%,`Q?i$8lGsoW\)pp_P %kC^)-6^b_-.gl[25V&4R+_0p3OpDFL=.k![d7q\f)*a;_Z4<pVaCWN!6J5a:saT( XVX#qUH9Gj=[fH<_iP"lqu_u4@JSRl'kX"]p499PQ/9boPPd)@?BP&uPa2_gZ>JSW L<S%6A0O`#1-rn<QP:^@[user]J[/user]>B'g1W>[ACa69Aj-kt!>@[user]s2elETu^HV]O-61[/user])mG4G][: 5a,I;A"H>N4t4T0**ZX!R3t4![Es[kWA=$$5`h%_h.CgSa8;`S%:YJG0mGg=MNQoH m'Z:t*VXJ$_BGYdV%%BP,JG"%&!IKXMBn@BE<*q]eU\R^Y&Lo"W_U.'7<D=4i#"4T JO?I,*;>PIpO5'fG[X<E4ftV_>#1n-QXl,_:$c>TjjBE^N*kd,RAM>lfrl@4A'=W6 ,Vq]BMY:8O:9FipF)9__X7[G\E@VB\ctrpcbQJbT";jHARDr-/(=8/tH>peu6Z-.? rBP5sP"?rsP_QL>]dDI,kuk3<R!#(!nU,kAWk!jf9g-j"BA&.$1n?WW5@QDIA/MUT ;Uj^<N(cTC7Ade'$9omp(s';-X&lG-=VG%AGqHVP*%m[Zok&>"W-V(Af[E$Bd5AEF A?eG)fQ="K5Ucj%IHr&Mb5rGpE(Um%a;+kX?WZ0"<B/2[<)ne$KH8Z=1?]JQqbi"_ )sLjuk!r"I>rFC0HFKEoB"Vl;0kO,lPj:hfBY\rN$6bL^'hU67WlRd:%trf_=6fA# RH,4uLX7Zu*mRSu:`E%#TA[(;*65JJg3-JOk;qC8B<A9)lbg]D+CC[Yd%Tu/G?";N %H_L[1[iU:9>]J_XjWl2Gi)^n[7QT7GFpp6MbB6OE1@US+o[:rpOgB['scl:^i?3T IXebWj"/Gsr@V'kblC%$ZlCl'1>MKhTdh+5)CE5Z[S+6q#/djs<u6;*fuOVp2F%I6 -WCJ2#bO!3\?:3d)V(]6TZp=jBK\kn0mVemfuCqdWHiG%V#h,s;Z'+KVJ(UT'0D1o M!/6(rOnGci;06#QZ?md&uJbunHX4m6XX0455_\Y(g3A"[OKVl[?`d\Kmg4[]SorV e4SSJPUMIj&Bp87!o`Oj4;8</QXJ+q:*N//2YT+Y`/gW>o0"o]i4G6qkBJAGDaZ$n l=+\uj9t4?9!G.5N7['C$@[user]1[/user];\D>W&,-!SNWS8&Ka].EnT4\.f2+mVJdl_r^)X@tcV Z@$3X!2kq^-'tl3L_X(IarahY\6=9<=dg-Y.9ge3(q>i^(dPj7n<4:8*8Pu*Z<@[user]b[/user]$ &VMOU*p:dk**L*rAB?oD'[BpM(p0BS"a2pJdd9hfUW)joQf7_)`2W.:Vij2]bbgmK W[Ki+%d28uN4Y.j>D%:@#&;KV*l4UD&u)l[>S:i=hZ@HigO+.n18)H,$M"lQ@gYcT &e0r^PCuB,3!B1_r>2OHm7o6%*4*S<,)C&rU33BR.6(I%91Q]tH):G;'j)p<N&uVf CXh'0n!1o;KN:PocnF(pe91TTe_Y-Gj"-p%E0YL+pD?"49'5%bPe\+PKaXWmg/6\b m+)X.U_q@gF3-LP0%:7*Ximp'9;[n`*pqJDWRR8"<g:0j<^Kj*E\2RFZp7Y3Qa5V\ jXfWoClf>Ff@\YfW:#G:\:^E;V!q20B^lI/UtDAoE(lcGKusWC5uNpP8`>+tMT$8p VF][1V=6\<7O\cg(JtTT2c%F0T#(%5qu3:+4G[e+TPP\^]1b&rOs.?]_WJU!ZQ8W& J^&r\9hqZBZ#SdV^iQtOg2c/cEhY.5\MRP6ZQK8W&a=D6BEE/JkIJ6s.mQpkR;$4. \bMJ2#nsn^q0k3XJ438Y(nC)f%'W57]Edc`_At)uPg[F&r0uraeu*mWJkV)+S?nr? n*G5R5Ct-ZrW/U-YHq<,2J2>81k/b-a*W\+"o[\2AbphpP)>Fn&p>DrZh;S>h7@@[user]Q[/user] &OU&"n)!p-roE`TX,\Lu&C$d-""\?1H6lP$]`1gir#_8lO[](VRP?p!Yr$)fXq\FA -WFR_A.VV#3i4HT-^f*@L@u3JS\lGkYS]=,eD>ot:,A!j^)=(S\n#J6<h'UTOCGM# WV^Pk#"\_g\<eHIlb6aJf`C?s'p$ke:&P:+Q8A"Or>r'U!1CUL>!X`:\ZQ;Mpk4BN r)\RNJo;4sWuiG[>C<-j=uU:2Q`I7L7tJT;93t/!noKM4Fo4]MV.rGn@f0Oe97C!\ 'VYs6TgiG;BTq\PH5PQ$S0"fI'"iGX8'1n(V*M_6Rg#X&ajZ-2kdiGlYQWqR.!P1c rYsp]F]47'<'=;k'<Ds8pcljS%^(q48$#dM0E#gA;S`$lqWj;5?K:r!fatBDmf<PL XPpG'7ajYRq`j/>)g\sS80g6g77s5s^`lK05]#p3GSM)mU5ZL-S@HGM$rJW"o>MH@ (0.FrIj]O76?H.Ej(1'!RSA"RLk,Lj$agEs0VL(;5.u.n'gRXH%KrHf_fMG,*q_H@ =b-Rr^-VhR[!3,7W!!b:-1]Q`fT\X>7JM/OkNIqFT>'>r#I.es3N<dZAc4G%Z&fFH :T>o7M[\<7E_X2m24pI,T"C4o]=[C3EP)FHZZjslf'IU&RYFFYkO@`aKX"IYfK"\6 N3demELu6Kf0+T"*Qk@P':;UrXHn?#TnG9N*laXE'Rc%[RX'sh)Ak?pdB6DtD)X,9 dWJ="RpjfWHC:($+j*P-"fG)*bifh0<!Z/I8<\ob.9(@[user]7STI[/user]$*-Tt8#e.YWo$0,d( B^lL"s#*BM<KlN8D]Z+]d,%^V`Na("3"c_Rd:0:rU<b3VO#Q$QZUn\@[user]_7sZeqOf7^[/user] 4$5B,G2#deU[>L9478q[ZmMmn,plY+23(Wi6"gCR![7[HPcs-8pcRttgUl4RgH@Oa K0-S=OlHF=%#:L+JjcB,Bl0"[:7=4Xi_7?c3qf0^oAWI$h#l&:F=,K1hj^+ght-c; kP%*B])c%XQ'2>3B,M8PXTAUes/2J$"1s4tF&-!5P><AH+b#.grn#+$F;V\$lG'j1 1"4-+ioO20W?!XYn#S@!:H7g7!\8gI!b.Tpki_d&DD_e"<[KXBqGj@QFa`)n3rE71 hb`P2#beHqf0r%k?,#XsgHG&ZgTR6gV[idfg^ULc@?!i(m?Im>lnKmG.FUN6gH>6[ 4/X$>"-.p(mjibT%rQA++4oM6E,*,eJRA?5&&^Zg3[mk=&l0i?e;Y'3+J*q'kOOnQ ^4)CM'R6UBQhnA6I'^3O9:`\XC=_V4C)3nSL.e>3IQ<ZOZ"\:U*to:4VVM)cpqem< k$J)bF#>^V'b-g>Z3Oi8Q+3&P.X,3aJRRo0MU/XQ0-1FIm-(fEN5J/6L2V28D`D]m 4enK-C/!MWj+[XihOIBYCRE8@o6pcK#)9o[CAJf!;IS>CUN5,5F*107T2l>B/EYe# \4LM9fIU[79!S5tT1Dl<:S9Te/g-A=c7:YHJFuo]ki676a2=3lis>K@_!.Mi.r^Ug e5%t>e$nX^I4!`&I(]__\o_fI8"eqe3UelUB`o_/lJW%Sm)48peD1'aZ$b4Dc`^Mq oj7cI)n]d^do0k`91*(Mgf9S5HaLMA!NW7E-/HcX;e[&Wa//-^9,^J&dg'CC=/_MT ?C8_=oaT1#W#)U_RYRcNSi,-;Z6\*b<kOVgb&b8T#$FgCQBM2WAs*%t%#e[.3LaNV MQC(PI'\kQ@*[@!kcZODVnZfmkb`?XMe8Gh9rsflfK3=cQnE\UCWh#;2;Wq%-7&sO @[user]gYsO[/user])ZQh<I=bq*T9hsGD<X7LON2`B5WL1\Hr=7$:n$?rO#pci\JI=I_edtUc\14; !aLMMi($nKRs"C0DtETD/USmYTm".>1>p#jN!3fdi3-mF'.o8h5=E8hQP?@[user]c[/user].*<gs AWC/h9Td"aO[WlJfIt@^+Ek>NbI(8=XLrJYg!BDKTV`X`%WBN.UK_YKh>/J,M6U7> eojP6(T)tqeng"r.El2#82u8O/@Fm.7XX&YWm:rgS#?@[user]q[/user]/OMo@S2<4XEG^I8mnp-M BaC!a0#rJS8Yjoir1bk?NsT[8(@[user]P6R[/user]&agOU9HjL$J3SZf"ISW&G9)\R"EQBO6PLic +&4"Q$[j2#XSh"WKphO:.20-fr5_oV=Zg@JkDcY.<ik:]I.kiU[Z^[eK<6+XJ&U;+ 80,#o(7/fU+GG`0g%X-(s8Gcf1U7Fg0U1lt;D"ZF>^s'7Y3`]uld9)%a"/cL(.DtS qgDH;K7.nKqc!m3W0mbir#*L<=J*WV*9#TO3f)dkKYtFDZ9hoR<i.kO>%*_I$SBAP 77u5q6#GcBBQJ]b(l&[*^PfU`g@Q0379eG7"Nt]o4b320JlT>*U`uK;_5]X^1)Xag '89GAK-_J`]C"/4o*h$'\1t+:23:EBPK'Q"HqD9KM=.0gOrq0k?k5.lCJ47+gD$2< Y&2eKn#FRY2@&XtUCpCoL@T866'@[user]CclH\[/user]!`?`d.K8t$4oDqVbu%OP`%cSm7Lh17:_ AQsR>mJUH:mCb(b>`TqufaYYA5R>(0]<N!Unrm!YOda\^jc:CM]3(Vd2%$+Qm&W"C .Uu7'm,d%^FhRXPr'`I-12NW'[a.V.GYDdM2g[h%?CtDP7YOLn7A;d;+oPqg'mMnn n=1`5HB)X=aKrmEG]%R*?)"B&^4j"XLhQGA$+YALDYgH3q4KupJZ,2gd/d+=K8=1E ,'r(h3h[^.THeO8+A#529Zh6\!O3R0F`M>cX^+7Nd,@[user]G1B][/user]/bZYRi=8)b`qn9YhFl K"Qt;2^ih%`,9P*6gP"\K?li/*F4'fkb'uOg/))X(G7JLh0cV0>t='Ta\ZV27)i\9 DBZWT3Jk4LC^,n+^'jJDEB9*[EjumbYYl:sq3o@SNd+l18;q0RmnV.f[.h@4epA&t O[0?Fdq]7(Ft^^1d=s$H"M'-8$;mnr-Cblfk**a+\ETqoRogKiGD'.GRIG]^2>\Q% [Nc:DFZ<V:.uAY^R&sfRW`L9s$O4'5]]\NLI.[-<(WfOYL\77(os]<Dq]!PT<-_X/ Hk%b_]tcH[(5=X)c1MNf/H]N%Le1tL?!;(2lB0CAJ:eRg-o'LtPd`cqEuY@Tq1?]7 B:B6Q3N$W9#j;#pr<)_&g0W5;k%dH"5J_l&m2umqEJm-pA,V0qU]?Go7qIe2JoR#G NQ=*8T-?-^NO'I[+QN6qS2O+NdII#<Mj^^PG6gIO9P>'B60+Y%<u3_8:V\1@-@<qa deK0h@'-$F_M](q'JgJBh2J?<K>TS/*U#eV6<BMjeYBX(k:%M<)GEtWa,%(BY&U(s 5`7'i[OBU:V-PN@4'+D$%ndiQ(9bV?X)2quX^mLOL8EE<F@V_&m[VjsSr!*'$^[<B OK]'jU;[Or/C"7WF,jA>%=%81[Ac^KLKOpXS,!7kbe:IL2j)g0;g4Do&1^Tm[0AIn ZG!M3M.dA<3me8d^mr@FZg,p4B^fMi`t<9]7s"/NZ5C`p8MnFAG<[!U7,',MOUim^ &IB+*V;O'=h\)U[Na^le!Oe[L)gc,).E*9>q7R*;?uZD4q(e2t<RF(-`B<$2=j!U" R&#*%jZ.;AV-Upo_#)>%2F)c0:7/j<6\k9:SRAjc4b1l>J9M:'&&&3'`)@[user]BGdc1ZZ[/user] Mo_bSMU.E0'!>jn(%UKF[B(_D[Ba$mZaf+K%'1$R#gln7&nn)obP*7OHg-RpnKX?* 1l'$,b]Xj*I%)qMmPBU]@[user]817_D[/user]?8R3c#OG7_Q*CBj8MNn)5MX3I6nYP.<&n%jimsj -K3jPQ[;P-ko%L]3eq7qZ-I17'f&Ks4'pK2*Rn88d5nEh<o%o2!F?=k.OZ,V=$crh 6BZD1,73E8a=RGR-6NSMX+77_?E:,EB0/.[gT>YTYqs\8rNmZ;l2.$8+?E&;q_+.A cMRL1pN`@>#Y4('ejWd3:T.)LE=L9JIOD&bBGD2kZVZgFV[`'s05>_3s1bCa4tT2" OL<JY6d34$;*CpuYI\?<6LmH0JOP`T>(q)#'Sg>]ofS)c>g`85f1kV**rTB;\YG": g!aY-RGk@"M6dlX6"2-O&;dARSOgU]D7-L4HeK@4'&tmbeTeDWr3YX/NmQ8Sb+-TI 5GGB4h,>PuoaKJEcX)@<"@$/g:pft"bu+5'Ith"%KK7*q3Ijj4O:grt<aM)Ynb53j 9/cb1n7U]fQSBhq0r74qMb_qObXjs;;D6>N]4u0@$WRRUh,(%RS1+2nm)lBGk7i\- R+U+qSSO1dEReOnBj6Z5^=h#j$c5\02NiNuRM5mDkKZ/S<TIrAUQ5RoPd+-WdVR`/ Ml;l"R!3eQn9B[@:af?iXiNO7H4*)Rh)"#2#GK:_Rg-Z]++k&=6RM./R4nc3QOP^@ ,FNt;Fl[<U@`"*@[user]^Mg[/user]+m'Ud;WlGl<mG8!CEN427UC@j.[Wl20p9D6VSlCQb^"@[user]I[/user])p gB>XG=LA<MMTt]!\1-S3\l=tPVs'5c?[oese(.^TB&qEY[*6rB[%L-X/;>n$`)8YN 7,0ar*n)e4Ph04unP-[tj([HsqO4h7(%;@[user]n[/user]/Ob*`J&jN=V0FR[B@'lpV.T?kU@!31 3F.GNGtMF`h)"\#HQS+X).0J>H?.-AUfNpOG=\Khhn_3NI">@/Be/lR8O78Mo!N\K E-:/c&U%uGj]'Qg0HrNhSC@MOkX?+h*81PJTt(cd/^t]lqs^8h9^u1I;6@J5F)]5* 9F81!@[user]FF[/user]>Oc<TZI12$h"g0ndIO[6Z7BH%?u:$!p69N&-cQGB.S;joOT+NIPeEu>2L Bn/Jke$lCnY(/TID_(*'8BEVXjZ%:XPmK.UW*Dg,+$.8:o._DQ0r;@[user]hp[/user]*iVu3fDi, ),LhuL:q+om]A/-)@[user]Q[/user]<\q*^WO/?-%IFSPfs*qoXp7I[UF1]apdYu]$:_1',^K*-3= `>l^nH:GEpF?CF:rEN3K[/#RXcNU8dfj**7k&iMI%-rqrQqT];YuHhbKpF\*\\FF1 N`ZbrX7'1jnf4`<*sR<D:Io$IRm_:+c2j'm=%&E[Q4!?MJOk5^2Ba7_,uQKj7)2a+ 6k4C376_G'd7rm7&0Yn2/<S9sj/obs3rH]h,#a!tjBj+_p3%at55^\tTlD%\mmH\^ q[gSB<>9EfXffM"X+>]/A8O'*Ch-tN!1UJQ8c^d9'M(YW.[=p""="aj.Kg1Y8h/*t R#k:EO!Bq3+fQIJikSO.>q-V[aF\[`Q$FV+"DXc!,/R:K3]^Q66#6&_K\Cf\0.g5! 6`,0`4l$i%GPHdQD1"up97?keY2/)]LmhRCXqpCb78fi<QkIHaoJ-HB->ES(&E%H' *62!V0nSoCNo:`Q3j3:af;OiR:WVjm\+-35Y1=Q)VN&K/;OH'MNgFB&?JAfL[;4ic TI0Z"G5m9gc5d^bcbt=;I:oir96,2MGFPY_kpUU,(:0F;Uid_>PL@!Ym7.K[,lCAl jFQ`riDX+@[user]]7_Ba6[/user])QXnE$S6k]U<,>Clm7^\g3_r]]30uJLY#,P?Y54lhMq"XI`UL =6J#C$G$JRLKbh2JhD7^0I<Bk\Q`%TF=O;urC:r%H,haE7@Lk/IR)b]kppXLRlto" J?8$TB`Y9bX>0'O??8!d1mJ41f7hn-59]o2r'.X`o5U(@[user]7[ST_a1cI9pA[/user]<aol=*lT =hifSJ,\dbcU:<[@[user]SU[/user]%"r)Lf)j\ZKEk^@[user]3[/user].;cd4g8#$6&/<'Eg,Ij0r]JaY/_PV0; gMbjg)S-!\FoQL`EW4A."s8@?BFEZaiHOnUEdrO](HbGdV6@i+m>;Kn<YC<(6+U3[ 3(,33]!^;H$X;;+Mm*>8:+W5:?qbU6,:2ToUe-pFB6g%!SSjU.G?`:o$?:\G^nr&` EQ\WYE4YFeZUc:YMg1,"IGd/T&o:'c;4e.X2iAg<pK'`#S*R4E+(UFsG--ob\LJ;% V9l,Za-6\CPY,`I<NZMhaA9ktoC;oS'J.R9Q,WIDHP`>JD8eWkMPI-cWg26Uh2Np/ 1NT<G.QnP#9O&e>;!G_EI`C]r[?;q^L50W#@[user]6J9Z4[/user])?a=QcPPYiZ("7PsW'00aq8e qe:<->OC4MFge_f(m^FR<(IA_YWMA#F1)WUj/IFF2:p7*b&5.-gC2<2YF>63m5:Z. N(W4T;R#+R`3YnoM`RUb@t,,g&I?kL+GK"%4>?Pm3C[aB1&-OBi1]XNJ\h?i%).Q. )Ylaj_,DM0=+e=JEeW\^[2BDPj[8Z>Y["^^)\,I<[0pHmT7E9q0]6+FI6h.\q%IcE qfkED@c<(L:rYG)D:5r%q.,F<#V-irQ>-q?;F'VX=j^rh=00]s)1.%G>Ks<#E<([> >guPOaV8.Q(8d\-168a;-##MmC0G0ZTJE5a5rFZPfWEg,W#1a"h=(kR^eaOSTDV2+ :b)rW`:A*`b;X2,2+!;Jf4u)$:_H\[[i]`]9#HtP``i?J1McdqXu>ZtiW*cilXm_r +B\Vj\B45ZKF@7A:k-FUQc4[=P`IZ6QRs;Ia`pFVI!eqElJ='6EQBB/(f7u8[0?([ []kut@r8RLHm)G0kPT1'KG?/C[^On<UNQ[`QcSk\jobDd3Q(%Fb=UQ>4;l=#j%0p7 3B(.@[user]_s6[/user]#%qY#uKF&10.;uP'IVnZL&,keT_j)2*!_<l`b2$ipJV+!(Rf%(#nL"pMO \=9Zo_RZ.+/Lo3a&pKg@ghep)'JQ))4/TP.-GQH@N%$rDkr7/D(;#&I-3A.0`#@=O d<+U3.)glhNLp\h9)g[f`hW2"F9"q(/>X/8kdd@ReesNc`s^-069'A7*rHJ\gD[RT lLS];Esh]A^Vt9g/J;r5X6<GfQeDMuR1.t5=F(>*Oo*EmQ=a7>/X1AAKNH5ZkY#lK "CW<B'hnk(cG:H-*PH'_a]Ve]CSafE/sHk!q<.sBbH7!?q([)KD<,Il0ClW7.:GU+ &S3A!9YqdEZ@q]r<6X_`=A*I")u.[enUeD8)KMeH6GE+8jBKYFs5gr<K:BC=3'M1' Zi_U'1L8X(P>s@@[user]Je8[/user]<d35GnId'P59V?79(/jg$O)rh'r_ibPP[Ua*5V`c;.2Eihi 5!YD;pk"%4#1>b1a\[d,ma?8*P6j%AD7XJK5Pj5/^+e_\g4*\Yq!%\Q^<c9>[O>V= `&8fWR1QiVT['],gfi%)C7:l+W]\elO!?aU!nL)DXFq*1(mRRalS[qGQA4^9;h3b6 FC8g(jL>X*g1<_ZGmRCkbi?0$7uF$UNCB*4+)HNcF4<`$9H&egXJB#C=1tp/0>noJ _,sY`q%Wr64?f(l!djhcFGT2oNXJ*E,,1Ympe!]/@!0P^"edO'92[@[user]K[/user]/20EA!nT]( L62V(RE;<g)EVH:c>'+68mlo];S"[kQ]FG5KSTqqqppXhFXJW!Q^=u3TsECGZJ$"( L&>DSr%e.!'Rk0mq,PR;7emdPr7^4>+MZbXFt:]b2b&hf@W@+r0GC0U_D=!r,%=YI 5)YF;>qBR"nd0PQoH&U+qm$TIe;5Y"NR"'?=L-nRH&@[user]AiFtbO`[/user])k'2"g2sR-2/j?. i@LFU\I:HUe2d(n1^d:;J#En?nu6::'lXjq3/RfqHUUGu\c6ih;=&t23.l*M!tuW- 5;nCNXh2q.IY(&JB-CupQf6?q[<r$.r<]LFZaKT!_N^*T<,Dpajc_r0!#uj\Xk?Qu ?H9njdUWl)/Knt;A'O2n3jso[0#A+Po5+[@[user]pRu\\[/user]=7rR4CqfO>1+SI"pUl=LX.p#+ FPSiR6+R9Sa<_gjQ5:X:;2RLj`A`U5SA=tuQXhd=;6EbJbkd_FV-!k!"F"?!_SKmN iS\FA'eh_BgrZffO&O\M6dkD+^B"^*(h-au>Spqh=l#W'+\)A,L2usbW(_MZp!"`X 4=\:Qfg!7`7pl3dnEQc8_ZJ+T_iK8n^1-3$PRX+o2kN.[h;1`G>3RV$%:l]Rlq2JN LA\rL7DZ]$STGek@S^u,N3ng6>1m&-h-F=9Rq##ak#-L#H-`NB<mI".!egfJ::HdZ F9V4kR^ZU-s5og@a0(WSZdR>Y::%Rf,QoqfY?3?kO1rIi;Hl9JJs!Ng2n!P'%drY' SofWJIq6<+C`A\gfQ8QqQW+ZCdq"8h%>Ll>D/=i[!$qk>1q6K%rbK$ZelcFK]tj-) SRi#3T;o*u7ZU["*8kuWS^HX7ZqF-TkB+1g;,XGkf,7P@0gUZq7nS8.oXeT2NE8rN 6si.mrTO6@,6Zs!GZ"*CSGh=`eO,<tIcoR-4Qc3;MTaIHT.257l-VLn6iQ@3N1uhY euDf5J^.1u.uO$@[user]Qc[/user]:u7SL9nNq_HUe=P=sEiWh!@[user]bE1LNdiY[is5`J[/user](em#)Y,tG'Z D3K>oh)tFFAm&LYOagg<E9iLjI]KOt]Nu)4kZXs/Y"QPUM]*Kc]HZ+1\D#9mh1I%e JT,uh&rpM^p,J<;)ULQsEc$PX1@BMV5s6J#O7lu@A+nh0['/H16a;ie<Y370*kn3T ;uPQ:\,`Ei`<'SGJjS#h..DhN[^`&Nf7se9F7?'-K=^;apAntGiH>8\[N\Q\okd,[ ,uS(%J0"s@^10Su$.f:o8k.705`0AYKQ:_24<Z&9<sk`E74:fW_*OcZCEgrAqg9+; Y\^t46C\I8idt,Nh\9k6!H,uNb**R5TFb*6+\Fj5KHX)j)<44!`A4>1&u?pI'IC\H 7=(10($T^V,Q)!chnXuF:PFu6F8Jg^r*fdN4#P(.:>k8:J/N(-)pKoa>9>a=Rp'aA 3o'm)]*P4!$(CDbD=f;.?YFKe7:%:VZ'',"JWetI=]7124j5Y+8$:cThJA6j.*Nt3 E`Ku(;*i.Ni@q$_^c)bg`e9-27PmfP'':E]US$G=1ia/RR"sAraFIBljS=.rLBl^! \S2$mTa1ipK,74'Q92Oe_o@3]Gg"Y*r_bj0YYmU"clPYlVMBgM$j2Jinp`,7M^"(! VfFiBaB4NZZF9\gQLC]</?9.]guP9OQpW]1mANu+BFZ^rIk4TR]Teg4&Lu^%&(.$? -NrSkPDbNm/3._)4F#=aO.U)GLAV:BUUf=f.<8`i!;V5kC\,BT>Aq'`g]QOZ(^qq> nE=Q>K.)hV7#oi\Mg(#BM#ADaVE1HlF6<uE__ji@W.I9D1tO6(c[`r)KuDX9(^5ak A'4bc(onbj)#fZIV6c#/:s%5s!i,e;KrT;)0QQf&`W-&Eb53k,F7"CkJ4t.XDPc6Q o4RR2BeM&_Hfl$*]-UGU[n_dA-6AC*IhbnJ;I_8ef3WW#Z!g;=p$bIP8$9\iUmu<M f"HK>9jM2.2,G'qm*-&P<b/XU=L2e^d4MIUrp;@[user]c0gh`Bk[/user]I@&8*mN?'r"pTQAjB8_ Du;*u]Q>QHgL8^cTrpb9Hj=k!/D]$XmJ;563MN<BR0]Fo9%XXrFaX>XqEPH2>8;OM `R7b0Z$>^TeNu(WHB*SeE$n*cZ]_I8XYG-D;?Htm2i_9.pSI0eS:8J5ki'S.Xm>l' i`0c\XQY$2_M-k'ZfD+A:OD1^Zf7jS]h:t$C$o:UJQ2oZ7+6D8<Luhf$D#I)<mp0R >)cc&3Iois*jF*!FZ+("=43o,VE^9(!?iIAFF/U%F^9qBP5::UIJN,O)J'`g7^Smk +'$^(UNYA]L[VUdMS:ulVn%)_e&80X6J&mS\<T@#iF%X*o@kfBV?:1%Xjg4AM[.\B KT37ck\mo"\(_6'#p.S@k5qe\j@EAMr)Rn;7C&c.Q^NtkD4Nm9q7TY&kU0=,%kttH +(pJ_.Qk\8\rilRhE^jn3Dc_kUr-G!O%IZY&]OSJXA(.ApKi\KSru/['.GS_(L4hK qp3S!j'_%jFu@%Q]*QL,!@[user]GS[/user],s/OG@=[Q?$b;2pIW=E"%"W7$1g3#ni"8]RO!0\%, [JG)_`I8j)SZ97d2#,/"AR+=EJQ=s*[h_t!;NKJTGpPTSeI/TNFOd&.fpH'"\6`[5 YHEr'kX3Uf""q(3be=^1?YN&I.6Nc[Au?&,GnqQTrEQMFAp:/8bN4f<,V9(CG(l]K PjFp?Y/sUCV5l12,mK8[g%1AU%H)^Zj@&[5^_NQuGI^"sVjM#idoK'@[user]B0L_[/user]#Z\i,V SIOXon@-AXM%5SY2.]@[user]CB[/user]:`70(YWqj3s4cHDqKATOh1q(^T1^Q<W?XE>(`P1cgW4R YT"s`PLaU&4k&4^Wf_Uaj0V`YC)_)*2-poZ#RVb^!)_gcbH_L,Ycto'k<#$djg)LK ZL#0Xj:[cJ7%,NU(o,ZZ,MGnjPGFCQ3b.2,ST__Y52,7FcCP1o8uU2\q0d^^pURs* o6gGp*7o>k"2\]YB0.e(TlI`R8*I+mcktC_%!-UeKK9:5Yo"Bs`aNQ60r"r^1D#;\ LsQ@)-C4k;brSgOU6%:o/Q[:dAu\C#/0]E]oj_OL#/].tL-&?QO+HgBYKeKsX&.dk QEZoJl$um5pmhAKF$&fs_K?QXUdVgkXbqI.^W?bGGX$/lV;MjiOG]!^%(V;<4H+'Y ad(7nf64&+??Cu\\),ehCMnlh3@W@=XJ.Km:.lL/3Us-L/%!+21,%7$@$53C]Jq"Y bMrDDWK_\=B^gBY0BcUq0p^h!).M/[R[D#I0kbQ[R5U1q"%r1njAH^e(@[user]6C5S[/user]:7%R p58P9I78(Zo3dP9a*II(7s/*(/(6s:0A)5\A"'#<bbrT&['5W>4M>"5=6K6][WbbC 'QneoEuH-nkcW!']Yr/#RA'T<V8*L^fhO8@5WHeEmbs_P"QdoG-Th4G%iT(/9Md\) M8A216HYD)<pc(GO]J3K8L0",7"N;&ELu[/nSYP5fd0@2\ReA-[D^Ck3V6_>*(J8R BXEtbqG=$<LOP0Y&6"mW6g!Dm"EZIa6*2Hl6=fTCFSH_,KaUabENqs9iA0@$T"@[user]7D[/user] Kubh]U=6U`276GL[H^44L6CScNGDMW#&[_)i!2@V*MS.cfN%.Wc*;QKbZ&5!h3U:o LG8!5I*-`g?CfNGD^]>6<RJ_f9%m!fRDuP,gko"![CfI!P4_Cu^U1&G`r3?B\[3`b aV[]BbhbLmY8dH(Y?QdITgR2t^WLUnnN;H]1KY]1FRIBd]#"Xm(5=gGhm%[[7="Hk **Jl#d6)W\,YtY(3@Dr/NQ<nPHkOV4>bcIPT!1>RQ)WEM6Qh6H?6KYNQ(?@?'A1%$ U4'^t@<j1GH&_tNjoKb%6f3W)e]t+AnT[\&2UPbFSs"$)>h^_"i$fT^GXQeGX+ns! 1XT*Dp9HHad[J\h7e)kZ*R#'9o)Nq0r\:JGq'ZU)BP,OK;$rLVEpMf()NEor&a'jF F;D(5UpOa=$uqGY,@(DDG!T-GNB/PR0'7=d34H(g%:IE6B#Wk%b3eGS#r-.jI&Y%U $V:MJdYpq3/ZX9"/2%`$41=mBXl[l/9)<??gJ;u&n\VMjA`48pM%6X*<P<I-r?DV- .*t^SD#.HNQX"l+_u+#YN*5t$)7/U:)5E]TA(KRoGtHuR!h@Fd8'HR+e*1=-K._Jm )/;uNXHb6e,CRd%;HQ_^4Cq5jR#?IHc?bq$5.C;Sm#f-egWA\kOXU's(e'gC3-XHE p=L9sfI&DH^^R#s%-0-G'k1mucAB*-pXD_BoX7DY*N$M&R=Xs`W?k5U%T6a?3k-@[user]C[/user] gkjldJWm:BHb!KD?=H>K9U('n@Nc+[j8a%g,U@neM!%$.\VSRnJlZ.0iTp$IcV+=G jkmj5#ObQmmQ2HY"WL"P5#-et'mbIW'9BJd&i4)oe6ZZPMa3q1NjH9C$s#c%kH=B` %W>XN]tI[p#>/nI)aT5jp+=)@[user][[/user]=DeNgFV3r;k+W#M]9Zn!T>)DKEED)Z_srMi^'+5 RKd#g?)<;F.S99?$A4lIXu["<Yk2a>Aa*:1CM7\^7/$K3`(fN.cYMK-kUDe(2LEdN QB$<O0MC`&(0MTkCHSm\gW8V*[!Z]8&\bH;2k1&gVs76G.NKH^F)3JkH0-*9^.;AK >AQ!q=4^#H+PNf7Nh'K]TUfuGB;_]KZ]ekL:?Q1M.><Drr$G<,\lg[d8R@9!9Ld;q `[*@[user]tR[/user]#XZDr4QdPT%!2l"Ffbn&[+pqnB^.&cetIrTTD$pM+:_2KT9Q/Z._K_S%[#r &bgu/PHceLFs3H%&,.gsUMpJYa6C;E*i.P<9RmQM18Oiffrm$8<FmVY9Z(D"0KAU> *?G$\Lm,nn$4g^;/@HPN#,YHXlM,VEFeAj:]"]?;i-n)QIRM)9R=hXIGcH/5Ihk(( 2eI0OJ)P(Q`694n@=6ENl(AF46&-DW2%+o\!8jF$gZ0_Y_`R1,1Co8?qG9=E<[Apt @[user]Usj3[/user],EMC`5\Bo-.Q[N6H6:f.A?IM\-Uj;ASD&4e)g=rKNTgp^]#AP<o8TM;P$&31 N%AoiZ=#Z!HgL,t2oaAYG@MHL_h>q`kgFjlrLrYN/]RbpMt)cs(ZQ;Q<K*j2U!Yka gq>rp%aX1QcQ:8bZ*Fo!l_l-sMg^nWncdFHI<q%@[user]ruDo[Pnn[/user]"\r7_fHjU)Hqj=V=g >uK<!=8gW>QY`gg3a0$d:-VCp&!*uN5<OO,Zi(M4T(4`LO!*PD\5."NX6!q$pL"(T ZuXK$)*^4Bd!o#KVQ(X.1eM.@[user]\i[/user],a%.^b?RX*^5^'uF6u+Q%X\HE#<VBt5?7\Y8GS !1p#]BQS"DCYE'bL$/%;fr?fdk\"Wh#Z);])OR0af4cVd6GW,ikc#13Y<'#lJQIqb ggP$3We7>dI:b+F>'mcVn]Z??T[6]i9dpqr>gIPV*8F$If)e!/A:eDNV0':gm5qlH 3o:dVUsB4CIe%RB-Jqo=E4=K3bD/`Nk#N@YBX=-4!Obs+#V)"AqgZa0-d`-PWSZe; -VOf+5Z5dY@YmBlD1YlLq7q-q""()MX0TLm0N3tmPS5!9o[GjJ9=6L(K-"^NT]-JL 3#?(\jQ23RJtg=l"qej!7Bh;,<inM/_<;WFX:Z:T,S-4TqUL*SM!"oYYgVe4Fhc>U 42$t8N58O,#5F8n@0Gp[1(495i]GfpXI92e)2=8>,*g%3[e[[g-O.l6-!D3n,DJn" #u0.'di=*>&&t_'V>(@[user]12[/user]"&s(rd0^+ka#dEG$U>[8,f7H[5\]KBX=4!r#aO]'j?uJ l&M.[1akt)DA3UQ,#A!f_hVc]n#jMC*t*K=KAUJF=qdk0E(ImR&BQF6[hTKW_M5,& O0F4`\cgjhY,J!%rC';oB*eH.;*k+PRt70sEAgUKci_c?<q,k]BaK)%L7Tk\O-11k TiW5`^4BauK$+nkH<]u(R*e,"^S>A5NVG0geK3J`IE,RU`RhuTC"(I;CR7Uh8ieGQ [^=DG7j"M5K[Gfm'IX)N+R_:0@OL^!%WUjIoD'!=H.Y\^&eabS*b<(i63%Uj(!m2h DFL*-PIaaos/;TSIa3C.g@og"o,q8grFtS>p\TAFhp;&(cBI7#e!gYpog#0to-1^? n],>T($-\jT!gtJEo)VeV.c-H@Rn,<l!no;lo&7KGqZ1<S5Q&+MJTp`ZD'W_E'h9" iBj6idn3ZJ_(O[\B\Yr&hI"n#kc>W`1<]He1-CWA0h7Xp,E'YK\B8t[Q)H,(&bkau ;b_ZuGs`Nla<4eT%fsTo)8rP%TV+Sch_K!q!g8!$SRPD"0l2IC7t1Z[,UoC,+GM@> +SqK/Z"W5ZU)sA4Lk'`jhW4))&A\RjoE#)'Cn)cB+Sl\c#2AW^@[user]Y[/user]=K^%7!.o&]CnS e3n*Q)e-Ck+VO`q)X3FiZ6?e$CZHmOnH,43*)Yf'H36Qd_)j3dld,\3Gd0'*B!J5e f5Uhc+;g,jH:a-K'/dJYBZWaZQ>@[user]Rj0[/user]<S'1Je]\h_4tHkhF4,(Lk:[T^L/r6-YWi1 Q1ol&d7\$3GUnZm[keR5Zq#c-%2k:8;X/o_*Mj5j!fl8q<8S<k9d4V^^fj]n(BS+6 dh)UN4g!)RNlhj'P9&bYJu.F6LcT8`&b5B<AujluT#TPdbMimRA`PAI$WY.\D4_.) ,"e^noq(eZ<pqMS^$08Jr-VQlI?HDOeOh7qNS:@)M@QdMX,b_TFT0UWoW^<4W@RtL ?=V2Y^4gVFZp914"k(Y)6iAEu.G%\OJ:/Cjk-MT6,?L`t(jn+6f-9,h<]?R/&)a&d E!6(IH_[(toQ7VGL=,"/!.GFW'7esHi.kdh7Y\OumG=YU.q5%$#mmMZ.6!]7f($_c o!$#"libq[(DUdb^ub/Fe;]:?<dGql/Rbm!HgjJ"Of6o^]b8bUGGi6gQbOWK?;#;O U>i4^V%qf6mnFr,S'5"[4_0Xq(2lELmrA2OMk_q3Lu2ddMCnZ!=hIiJ$eRQla-#WH 4)Ku/U.4+O`gKP=h&*iuEObZBWS,O>Ge-1],P%te\2)>[G/14W-N8VUf4cD?BX$=[ 1N9"HP^"#e0T2rA4uWp(pnX]<]B=P4=%3mCpNZNshWg]40iPMMaJ&.ccs?o\Kf\Rp O<u;4'L_n``tREV\MK8t4nnL%]a":W=_d;\CCj8Q;AQ!<;;`'r,lB!s?Fr+Ih.`]C FEC!j7Br%$c@Kgap)_6gG*nlJ7-"7q/%(;Rr?K:S^3Y8<S*N+[r'>2/UJ'gTd[)F@ :`Jp4$=,HEq[Xk<]1LfT)m5:4a8[-O(V[7`^@[user]Z[4IV[/user]'jR-tU_uo[L73#LAA>%0]ni 55ng^+Z"E-#ONM43I`f"g'DK'E!DLRC.,b>cVfmt1q9sR<9jOc='][iI(I^`6K;I$ T^dcIZ#WB:FsP8&/%ob'.i]4,/?UJVD),<T!Bk4'Wa*#Zmi-b$-ZH&<j[E%N$M<:/ S$fk.414`_j3a?,'M_YCq["uTWF6KY;3]e8>5HOV3^.+$LL$'B%\(B8#lWO/.I4Vm NZ+alcK1>D^OOKJZ0o"73cn91o5IKC>J#BXifn.J\g6(n.oK<I1s/*/PLdg9=f:'q VY;"67W9tqCn58L@P[g;XW448C^*d'I<.tk>mkqEGFHe-0]gahS(-s^+j;FC7g\Je '5!%3<ZNKf,cp$XW6NO"/',j7!uI#&WL^Y/i8.>H(/YA'<P9CWDD,_d0Q;GrEs,L! ;Ii(aJUq#R=*%-X<WD3/^<[Ipk+ppUUu4/]of9T5c>Z:Hi0Ij[>!Y(b\>4'C&QdTp Wd^usD'B'@[user]3BV7bifDVq-3G[/user]&K(gdkUW'Q_(^m?bb^*J5I6Q!O!5Xjn9s%\7MB='dh ;QJs,HdbdA]/^K+-j*geQ7baXH23BM+0gVjM1/%\D9d@V.QbC"qat##WUa`5J6%nC <f+j`\&0#_-5T#RI$aYNkN003DVqklK<Yr*hAR?F`l<a26JmHgZN!^Qf$E?&eq#&n )^Ba6a2s9H-]3WJgBI!VSp+p:i(A(;g2H?pY=]U!ZrB0BFOkrfdV9]Nl8/0+8#57T 7)<Z?k0,1+>\U1=W]ZVrl_Bc'5$^lMTC/)O5He3QY\/1JQEt9+r;8c;S6rsWl)*)' hU>T<q\n[R6,7"shtN:tG7"g@ZlArtNQUWRjkF2nD\?-"3L:Dfbm_kLOIOHs!Y(^9 MoDt8as0Y07i0:7bm[Mg??bHbRlHn[c7"tP1!AKDAM</'Cp@Z)ai^AE4<K=S2@@[user]2q[/user] ^0Ftn/._3$jM%9^lTKT&i&45F2k[ol-KdK?2g5LE8+Z*lPl%,f2H??jD:bJ=N0,,l J1CY#:*eh+1U*V(i#m=fB(5TQd#ZD>BI%tN;9@_9cNqr_l?-Bq>&II'5;YtrRMu.' 2uM'P:+PXX%=/4B\psEDNV%aPHkbJ1Qkr4bZ%<cbVU.@[user]uQ[/user]:&F6*_+=1"0IhEcoOd@ <#%jf0DOmtj*<M):rFQ2_IbuU5@4,A<Z]T]N9JUUDGU;^Gg<-5<eY]OGR$Ll6,*X1 6GEoa@.6)LD+!b_'PLf*:l8>OLui/VbE.Kts%iT-V:=R<:V`psJc5f626.;SiM]08 ebE-6Y8,##OM$-8IU1lHo-oe!5ZmR`+SdhmY:XUg&WhC/F@]R>P-6gqE(<VZ&\L+J q0nm4+eWU.p?)2$r?1p<BD2RK/4fb?OSkQ[9q&*MrW`3r&H+(0H,7TaB_5A:@[user]U[/user]:S@ <$3uBrM&j="ca2]"k7;C]B\U0<n'jBgIp2,[1__2Xru69HElKu'OqqU.L;\*eNYL5 0sWZf!'k\3U!caNK6b#Z'hK,)Jp($AP_rM(0!Z7\Tk+VcdapSR3'L4i,6`3%0BTOM ]R^'!oF:DR.G)Mu7F%E;+kXuG!PjJ^/?#ElEDD;Q;@[user]Q]U[/user]=$>oE,p)S7\UMRpX5B_. C<05AGQ=kR2!cgB>%9pSd,tfq6d2r9W$!E$MgpC?<0dTDhfJff#E#Uq/TM*]L#EUW dP.2!R!*OW>Fs>1gPko?2RZpm6s5@(&(>cc0WPKQ7OCAt[;YmE8<\G^nt#24_`>75 *aKNDE/>')d.2,/b<78Rl]1"BP'-5hNRJd.G1PKpDG?QJNWs?(dJ1L:<<FM\,,co' )asg:JVANV06UbGpRHU)!A"W<"*lKe74TLLd?k1bU4:[LnWCkjGr7mc;eMOZb8dD. F7/H'5*BVmRQhf4\A.M.I)!GbmgK/WTA^qciKXop[3&6:Om1!Zpa3<nah!``nXVm# @[user]YoKUi_[/user]!$?='X,]KI0d,VQ7_<p!Kg!4h?:g\9d1.fM/PUM=`C4S-MLDW2*L53D^O< 4/7WaiF<m9OF4Bu0&\%kDJuFtot&'f/4?[JRr^5c_Ap+4aV$dN-TYj5?+hK>/f1iR Ee>),;M\7_MU7J1ZN6*=6KQG]kZ!oo;lq0@).3W9$@[user]Zmt[/user](<F>FESV)DQU?^>RDZ'8 Lf^BD8&Le<:7),JeltoCLqR@1]h$lZ*AtN@O6n*r=8keRog5:Fht7_LI:d#0UahfX "#NLllgaEcN,\NEr.fnAQfB5ij#/lr4m_;_#H`5O/D_G7PWuTX(-T<3.d+qM\5Su* +%'#Oji-Fa4iY%Ha]buUb2u.-Qu&+WO]#q*VeG1$@[user]c_LGYsrWBPrXIG\^[/user]cM&af9-% (fUr)moK/r#5ObX[M!KgZd@ao4iE]I<J+;qFmq=r.Jcp[pLW\TSF0%5:8O[<+nD'] 4o&Tm="NNVqLs@cr't4kk^ctkRs*E'@[user]\Ykc7[/user]A@%QF866hja;ep'lgsI3'SZSDpO6` _Z0DG3<.gU-u6\X,h2pqb(/eN5E-riIXXY%#3>t]7WTZqj>I4UrXO8jT(jCD$d_d- 8JXY&-DldZYcsHVE+qF:#iS5IBfld=66]2cQ,hT4#ZNj,S86MLDJ68m\=rJ(4WH#3 pi[o`I$F(+Fb%04j8:EC1Iskq\,#UVpII[L6stN=ltZn6cV6:BL;W<RNAFtCTT/P3 Z#O*FNRLXuY*GZs)5ml'Z5.,I/8<m#E<Lo6AK0ZW_nLYff8)EZ]=t0!'&[ElM@ui\ Z!It0-'#V)47-\W6.a"2Od%5F=[eeKVip,heYQ_!OE*N/2$<I"+1#oI_nn)a`E4m] `l1i>>"cgiQUf"UqKS=3W6%@[user]O[/user]%_>4Om'Bcl#tm`+Uc&j]FunP1/?i`bLW,@[user]^gV[/user]*B= J`O!*LBlX`UtqUYc9_(B4FQEmj!RUUDG>D'K`+4=^B?4k]AMbT],WGY__G,4.C[83 2?iCBar5-UU*H,@[user]X[/user];uR*:M+h0?[]@[user]pBZYjOkt[/user]+<;MUpJ.;ua%M,ek/pNY-M%O<_k3 fq%QG^pcEPK%?:=R<,19Bs?S[H_9d>)!<GQ.HI:PK%=9?dpMF"ZFI3jN+K;`5[8\/ /\H*9WpmSRbBnM#fhY]s:XTQ<#d%Z8>,R4,bb>d2\;?$VU/^Inf2'QdUh1GW?VA>H ;Xo+,5$!Q<`%P)i`ViS6+@[user]jB5V[A`W`Nb[/user]*N2'r5e=eXYX6Kh+'gh-)kM>.NngaBpq 4Y/4MhLN*5p&:$,cls;#B1BRc9,EgAeLMbkSmu`6YdU'gDf_6,icucmOnI\qMi(BY jLW5`YiV&B;[#PmBlGRZ_:\uEZ^#p'[=3qO95=qBih'9:T7O5V+`7Vr<Q`Tp>G0Sq 7[IiN$Au'W9\AVga\@)ZHH01p?WGCA=?;S[ipXsDAts-*anM"pXH9N/78'[sV-%$d 8Dl\5FTTPJJ5k-->gV)cl<8J8*1c\FM:K!i?<sfBh.#nmUgJJ_&q^*u*GD_4]o+Dn _Jf+KpEp%?4Cmq*@[user]B[/user]#faVn7%2GlC6KF84+L0EPH`j008)&T0l=ae]qb-5htD]?E/X iP(TdBgB552-.C/>0kVSfIIGWM%82N%,E#2&?!V[LdN)'cGCSN&>i/DEXNm#YF&S@ -7.Rtf-ZcqC2eCjf%iEBjs%nIRTXdS?_,ZEBs9FDlo5:)/Kr#g!hI$+aC2'Pg9&R\ "eY7"[e1JQlM<&%Xi(5d-Sfm[df-hk#QOLe25ciU&I")(E<4e@@[user]d^r1^-qaP[/user]!5kcf NsbCB`s]-;^D7sf0`hJ%0<sTg$h6$_cjBFs#sgIA;!f\s3ef*'ob9^RoQQADNmU]s #s,-A@0P_9muA!5;XeEZ+)^_H/(XN'LA1qnJ/M[`q!c;IOZ_sT+;W_o.c!V!:2:.X q%,<#[)mGl0oYP9?q>FJ$RJih4Uc4d,dR1a;HPd>MN?PA8J;J6r-.^FS*7WU)-EZb =WAMK*?RPR5is9n=RQdIIU=(=5qu[`)ZZMMa4\U&+;C,sV/sH7$Ml+GrHS>;Pa9%< 1%-N,Eo2Em*]+0i[9"g">dh7P$f!4";$K^JFHbf\P=[4mOB2U;4KMTn=.\sS"M/@5 Wk4hj>Ous@5et^e^ae`?;TK\C5=)Y]!fX`s:lttiMV%MV,_k)l\U^:Vil*l=H80GR R0;_4OT2c<?*Sn)]>g;p^@B@hNpGQIlAk/@Wb+LOVCo0=-'(/_P;4(/N_s2k+u%O] R'p_EN)=!:KC)VOm7s]T?&Z89lCs?N#q*!JRLJFPo-NpO2XpWA[Rul)h=;WrPHU-? n1WbSME&DHWK#lS@pTaT0I!/]/ektP:>u^n0mFuc,NYb<H`CO1JWuK0;I7)!*k,2; Y#24"hJBo/gZ<8W+^/2E$or>jK9hjV8n@K`lAl5V)HDdi,JJ%#K:eN%BCWHaKD[\F M,>nV`OITrj'i@3b/Hi4Me^C'gCJ7s-!Uuj?A`f$L6o1?.Hs:[Jg]Jp%!MM/m":Td P?Xf360<fj?Ba/LmbA&4RrB>%XUnN)aH:F4:nh3UUa8F4KVl=hIuf4:I:UVI[8#eH CkEV>MfO&.E`B\T[b#d7NWd;$V6YY>+n's>]-ke<R67BEQ%3>LqTPJ@GlHBZ"+KcR 3RLT_QK.ll-$i1@Ih(>6S<CW9g^ogEJZ\--iCh-LP5>)BeV!,HVs-R:q$DX\3=GF; _K:A!AnQJA.(o<c;^pW;;]nl1f*Zgm7M^OO<?A4a5<$he6`!QU3JTL`b+Jj`PUP4? kDlDsKpt7/`.>)'E*,AL5U^lZ'><UcL;a"F6K4nr@23+c)@[user]TH[/user]?fY*UVDlX-[6R8Mc (DtAkT<W\A@D9loS%R(OT`*lR)kd.,Dr=Ff]W%q[XBTlsRb#n2`4]'/Z4IMn;A*Z, ONVg;_e8?2]DVIuD!*"!SVu8T<u<6[*!&?5/VSps(#,OXF[E,UG5]X6M730Qfa^c- W(>Aoq(GC5IX9o7IGX.8*hcJZlqtF[h(#Ui^_briDH?JP1@ou\Z5t/9G"Y5$cmYSX #p<o$8\&ZcC"V]H#XFFlWEm&#KH;?E8VmJ"T.BO6"T*`k40;b]%a/6j'mdNE^$;e= FP8%Jg[!GGP.jW]8[or#X2YEWgku(21QPm5]@[user]7B[/user]>MXaVI,Ci-6<(rb"ei6?\]Tasf as$L`8<N@cRRmoN"EEF3fcE[g"o*&bn0&<SeV(5#dNjU+^UK#F^riR,+oWK_X0Jb% cnZL(\V17H2C\;MP*5(UXI)JKJ0q]DHj,@[user]OUX[bZ8[/user]:SQ7G!c&kLO)M(.E-b7Vi0&7 qk6&6>k)e=ouJD%HudD[,9fn,]f0#PH&+g>'Ja2M\9B[A"H$<Y<rraD+eSj6`6K,V #7U;Ch^FK<]57+d8eK^/0<%[a2q)_'a@O5p"N(?D?L1K2J<;7oH+;b#J=noaoZa:m DZBo$>`p"^DrQ&MBtS3T>%V4R:MnGKNG5SsU'eB9,/31I6&"&N[*XVRmnj9dW]^3B >:e/?`*sju9e7cBDFE)YV^Uc@LPUO+(Z--C>JbgFT'B`W?59@s@;;Jeom3Yq(:u)` I2r^`^!'8OY\\j:2@n>#5^'7]4R2=qB`)N&7pJ;HX+F1'8b/,h7`^(-`a?mI(3;nE !$b+4OP2623)gP$(m-L`hN@jI.%JMHRhQ@^%TqRH-9+g'\!R0"&Y&cdEU@[7&bB+E D'N5e:6/?o3_pd"H:7`VCsnKmbK/k"9fs=@[user]T[/user].=_u_rl\ISZ0r?).+ZtQ"3hI67H`6 B7eh2-oR>>3c<?<nqeZ-o=4%E[1'bY9-S4e)Uk@OX,c6Db'^9C:`0/4G/W9JknWCm H1VPBTP0B#MJ6;4kBsrq](2_4mlC[1'rbhF-W,W=X_g9JL"_%okBm@o>qp6>=ee*l >ZKYG":LFXTjg/oI2b:fJNSIdhtoU2:)H&!<>NNbib-dS^.rORmk)t/Z*;1+)M,3a NWL5"k(m<.Zi^)cl7bX"e[&l&0)Dif6gPM5*;#?CAhMWT5=5par(j=k+"2rLL:W8N .mCP@T<n9,#Ak5T^*^Q*Y?+plZ#5?&QY-#sDu)obLqLR.>1q[[H0_aLoSL5O<jg$O reAE`pjK,sV^M1[X0G$bn0SmUH`72KH6HTghVJ9O0?N^t8hE!7>aD&!EM1,iWFHZc ];E7MF1%0tA\>Y*1Z3%^>a0P\+aP&G#ZI5Z3<Y*Ki#qNRSTb,FL?dDkXb\s:>p%0g @#/(j(chp2moc`(SS"W(nNQcX<0oe1(L`<2;_[iWL[5dTSd$&[m]!$aN8Uc$KWjOc 1.lj3kIMr$25(<8lpYDD^\:LJDeu@*8E+H6TGQU(^-R?14+\eF&pY?J75[9*EH>=D Y>H`8-hr14[`16jd.i!%]G:c<)NTUdNSA^@[user]JZ6X0O[/user](u=,ZWV#?ejCCc=j56;fu1Xj `XSa6)C83rTLABX?=J(uJo5]A/P:TpKkV1h/5!abNiEZ"F)K5l/lI4lr1L\TYQ%AB \-$D<_"!$enkFS9T".aIdQ[`S'aaMP1]crn#4VIZ!jBQM?Lbc)(XQ]:C:a//]Kb5n r?e;]-Cr7*f.0SP<gjH'`k(D/-:n,6g-"k^ktFbjc!BRce<NoK)7s<"hYRDk?^iab ]eSmSKp^r#/945[7*b"#[;9j@Xk<(cXE9<T4FPpt,[k8uWhPW/PqB6)?&:@[user]`_[/user]*a7$ STnEAK?P$B.b3+g,!q8.AoQo(fh-WT`L0O`B-O[%`^P$oKG-=T-#d`o/k]i/1Cq?Z >a%gr8XR:bi4D+Z/NYed7>k-#Es$_W,@[user]eImNU4[/user]')7\8bhI*fs[%R4VP&]*<B]'<5c 0'Mgu]I]hPaU.-O'd1sW2ak'uJ.-B"?]?.rYt\IA1AfL]+Yn(c2Ioi=a>B]0e(4U< 5$^q4OGOT\N/pFT90q^H=ci/KY#*?`3e\P8L`*b#MV<Ki!1P#!1g^[b:72]LpBZDC !&Kf&(5^Km!]+:%$c-PD1aL;di@`*.fSLJ+36dCE!G8."Qk?B75J%*N\9"%]U_s3) 2,,kOj71M"Rbpm,>#)^kmJj)_#lrpr#:*#MHiSs^,qg]4*klnB0Dd,GX;5V1MdRu@ ]$Mrr]s=%aH^rBOlo"3Ok!uFD^T2547X`ktFs%b\AXCd@fD_H<<G$#Hm3V-/eR>#\ Ya0\b*,7Y*lgZgB:=[^#r?lV)o643BA<\Ph\kLNQCt2ulfhYE/l>,/#f?i<8O>+U0 Srj,Wg5]!6E1f6;pj&88#+Bp,@[user]\\1m0bA[/user](/#(ss$oN=\uThpACWheb</+cC6F:0Mg Z:6U`c&#,ndpcH?kk$og>_%jLN'<V_LIYuUop*ubP]0fnn^a_Y>9=;=k$,XcVdP08 Z].f]+K&/t\P3t#bt!]T9"Z:_(G4SRip`$Jccbh9mnehc^`0%`&cI=H["e0=/E[_J "fLTf?tW0$[*+l\DVs`^A6pCBDB6A-knmpDJQb(LPWm1qnDibbbtAH%A?q/V;=1mY YWar7;;WOapb-(8%Hldf#0g/Y*0T@af:KmBM<bR'T%#V%USBO5_145\1n8Li>-u\g NaTW>/,;/si0WcB5rg8Mo?clt`F^RLjIgcJq#])T8_B`:QHRWk4(n$3ShM+cq&0:# ;O_J_77JmJ!?C96fE=]qJ\ZM5988b)G",f.6%I)1L:6i-Zd([$U;*.h\M)@:Sb4Yc hgK+SpD,u?q6)=NUY-i,)@[user]dP[6CR[/user]>s23!l;d-c"C7.bjAB&O`MpSS<Mdc#!,/(s)d Xj5'qZh_h2CEK0/H\l#>YDg4(-!qr\.kGb\_CT"H;Du@:TS,$\U>SEc1d\V9lM!`? A4,]b^((HAXp3tSJ@qD/ep:j`L[*:k%YRu5SZ-JM7lMqUpY5%2F*u8d?B)^&[CB=J b7s\"TMlQ%JSTT\r%6B=K`l2ZmL?\Y+&U)'Fh7\?KC7A,4tN6N=:Z]H5=1_dJLs&t %`(:$29W6Z4p'V`fZ?'+O8mR5D8AqOB=PK']+)#XR)ud+C8I-qRQtQ7KMXJOE_X%H &sC)K,sVkC@iK6#9<p,7/k]C8fj/<G_:StH8A8Q;_$!HQFLW$(6OT^65_,^<,_8XQ 5WYGu*-mQWgAe88CJ(H7mAh:MpAb-\s"=6Xa?H1H&fJ!2`NLabHJ`B1++.\rlk9._ i;..nkYq&NW+7\?b@eZSfMEml-K)50B61FmCZ$k>MKCk\n<XLX*I^sRGRJqBS]1_U [2PV-1fG/lBO:[U*\W[^bR3g96?A4i\/YJ_r7aj9Aq0`a#QRm\c)!;.eGu6kIRS+J ;-j@OV+%q+$:MFjdNj$,i^_8Vg\su<B@uGWas"ieoZKRTg#U7>>-#+uL:uik2b.N5 ros2nSh(OdndJh3La7YlZTsD06JfNW0S?Fq<8NJ%83i\J0`*/e4(P\DD;l\r:dUO, 6ASH46s<;Y=uE!8BJ*#"fJHQ%\m<Tl2%d31;EDIZFOGHGgb+s!Olr*fJg1&$_9^XQ PuC#Z;US=aQnrtrD$+?;l+[>N`W"%)A15pJPF`%,f(#OKB`/n:M(jc.OU%lDeisqM *=Zo\BQ2.t1)*3!+LiEt[u%3gGIGpfKA.&UGs)USl]^k7EA4mcSd=fq;+%'WY\6S[ *O!BmGqrls":%2D6f)6'Xe'9HmYI00$$=[#g-T$^OhZ4P"r!;f_NJ^p(:^Cdf9"(< H7F*?D(t+"5P7G@2iPhel$XoVF.Smj]?*,C5!J,CQ*7CrM[\YQZ9ldaD\nrs]ADMH 4Wt`eEIOk>&h0atDiWDVS-j?.nP3.AA<=LqhPd-]Wc_sPli",*Dm7#L<b1P_c%8;Q DC9`ZbRBoV@NW[HMALmm9VcF5(/?0`WXJG$]3T#N<J6lQk*4+K+[\9\6+TL0P!a>a +<#1HnFVBMJ1!i.@[user]5W09`2Y[S4][/user]$Gt5\cI$$6V2t3)/oR2)m[FoMR*-Y>[E!;`G/8 =]H1Nc@)6NlA-c@1;Kl=2g@"H?Be+Oo=`0(1m[b8qpUp#HCP3NTGk:D1lr6p^`pJ6 )h!oaF6qVnRu1J;$G>.:[/0lMD3=Y(=(0C\/^A#q2<AqtPmGtY%slrh-QQfC^5h!a 2gOBfYU6[FOUR9.Kfm4:UL:2A!iq[Qb#+K3^f!`u$7n^qYg!_SF,G,`htZ7M-G`"^ 10/YYPPq`emKpVp6XY1pJb>@#PLrJP>`*m3;pE)%!a+3U/8JYD"8=k7%,CoL30=Nj P%<ncgf'79=<J$kYjYt?h^W]&m,p/P4oO-'78$=j",CXkfn4d3duIli=teHCNg80V iZJ!jMVVhqeoqMF]XEuR0B`f=\<D1[X_REK>,uC!b8OYl46h!2]tLH@c1a/?P,I_$ 36U8`M+Khk`Sd;`GVPW:c:enA5`e`%JelT5PK#"&>,gG%\HZ`@-@[user]8I[/user]<B)][qF_ZO" G`!:klA6o:Mg1*^j^Ql1BoD5!Rc2Iinh4U8AX8`:`chg9/Fd2$+)WQb-"PFp583m8 &,.>I8WN@4!i/JCE^,OC*nSOq7)ig9^C6GGfu'N4b/"?2,J6SLCKoC]-V]"ldb6ND frb'g;HgnddhC1D$[DM*jEVLoL/E$5hg##UqjOAXrlNLmWODesC?mr]L>ll)BPU,J ?#1D.f!L[MQ7GY1?*<"%XKOXf*"$_s)"BC4B($RU@3OSMFBnZFK8rTINjoDT9nJ?[ 6hEFGlHlmHC9?';-G[eoA#3(<BNSD8hV+R>W`1?!`Cgp,o9<]dG1dffJcKut^!qtq FuTOYXt0-kV'@[user]`[/user]:[!/q]93g@fK^]SK.H$/_e^NWeR$G)<r[A^@[user]D[/user])<u3_tTc(TIQoG H,,%fYo>gh&T[o$i^%&eQ[%,$%s!Bjc@mujTf</=_MT&Y*s3#I!/Jth>G@7mEgW2) qJ5SY#[$>*FA+H'#%I?\$j>N*i=7/qSADZSoAa'ko&T5c;e!TG^<q,5rs.n.55;D\ %F]&ho-rBOc0dWUqWtX,85a`<#+^MsDNN#==c+5Kd%AG7YM7Y2G%1YeF]RSL`iEq" )_$abZM$][p$V/PG6PVV>c8.UiF@33(n4=`8n,'Q+r1>17g_n\4]PCl48+FP-ZlhT 4lC+=cqnRmW'2%^i'$&CWt7sJneea#Nc9]tkmhMa]L<M`8,k>[X7Om[n2c9VgF:Z0 )Y[<?#f@RX-1K7sb*'iu(W8b:cTi(FK&dQS)[.B.Mt$iiPXPVnq#[9!\rm*"nob,R f-L.S4Dbd[$\0<Gd?NKTke(n%Vm$Y*mK[*tE6O5]l];M.>mbrIOPIl5m&`sfRAMU7 L4.MV&R5WEb.!`R9CsC[Daog*8pBfl<hGjGciC5s#&mN'-Vdc%opLZY7POu`7EtQG `AF\o>YaAM`"uh&F"I#Q)8$XG%VYZGHDF^s+Ym%Qa:T!>T"p]B?cWkM`Im-j'Kl%O 'j]#X!H5V2_AgHmNoAP[hcLHQeqfo7`Hj<l=[qB]N62`G\2=b(Q/_%Km#.`E<]+9] `NmKNWItT[RbftRZ'?[Ii4NF:?UYh&$TRhhlt>OcOkT$lB)FtDP`:RW#\>HCe[^K0 (-1q9j]/dc>8=O-OX]H02]RZ]6lbLJmsh!#YtOY14^QHtT-2D.9(ca:."VMj;L=,/ Gn7!_"?nOm`eEJ&3OMe3&<X_=>-'3,B[\S<4^I4O)E<a=X\`\"EgU"gb1U4S;JCI7 98O$=q)Bdd+6-QTo3MB"?Ck(VcU&R<V:HIl%,+$!!E$U:KZ5_>+uG#Vhc/HOj"i0% %(4Ibcks2o`9eOaiX^=OZhK\;j_FHX48uW1X:K/t93S;G;P+cI,fGf]j@lbQb6jPP KlNG;Fm]-kHiZ).^P8GOY=a$2paMN)M'L'c@bN<]S/R#qe@6"8l&GIJ<OouRg=/5m Dj@FJ`SNLigjGYX2UQtWUg41`4!Sa0-_COZA/r=W13dVb!D&#`Fjd.mW;M+[*cXY. :n-1kFF3bUE3%V<E2P3<eucNMf^aGS3;X&:WB!;q\$>'^jIi+iiP[8gR!hc@4#m#H :uQmF4?#:q^0uY$P<ROWWQDtF+5F-S'>&&pnQ)OC7L+]3a0*;;0fjQgb6:jM`VuA& EfXu+53'/u]o[A/]?Aq2@1DV2U@,*uD-*VND6)*b;nPs['a975!WeGq+;[Acj\=T: hLmuLQ4P0(6De=!MHK0UXb-.hWFbeib]RQ8:MmS4ZQ4O(^[,dOhj]-beC1"+kNpOm oB,dpTBH#tT.fuQ'sDJBQ+^JU_m6*LpN];9_Y1MCof9?L1tUn@CnG3WS&(ga5:O2k :YQp2Lt!#.oGc""QTe2)<(sQVQeZ8_:Xj\E4OnU<kdCngR(l,]@[user]B[/user]*0XN"Hqb&Nf*# 61LCf7!>U5ZZEq,ZEmbrf\'U"@<tm?MISD6=LouFTmJ@HXrO.!k3[_*o\jK4b=$W^ Wl;mY8'Q^f)q39hE7X;C12?^o&h]TC+88.bLUs+:m/25]1dA!,&Xo>84?o>*\ch3: )4DYllpg0rq7/b4"m;fWX7IRVlU&GDBR]^XM5H9'TBF%"&l.\.E!l]lL>?I*;\<7A ;ec(V0;"CVjjEYAL(Pn)$?kYq,tr3!</I`^lSM4/6c%jE[]mlQVqrX='rS*TGpVt! :icEsbjs[EL>sVs8-G!o^;2^M/6(ZWL"j!76/.(BaF*J8a\.nDS'pJ:;a`c/PrcX! e!p5Ylob*`oS6qSVg(-B?hrdVQ)gLfoHb#1!FBHJE80+NQ>3T":[7(_SkZ'1QIFbP .Jsc:_ga"8mZP,$,Nb9gYT91B?b+>qQFlH+j_!IlV]JlVlF_0!1I!*5=A%Kc)G4$h ESf(#UJg4O/c*(a_Hh%jSTZ0W'#@;CkpHBk['IPP)+HDG^Ums0=]U*45WhX$,o@:i n^`[h>V[=3Jkm'LEEOi>CMQdZd"=17a)kc*1(?j?"_5mGm-m$m1Rt52g<]#i-?,I> DF!bUUScL#ci^.9oL9M2h6`H'R&QJK#s"UdE#MfN`m@RCZ!]ScD$f&+:4nJ,TRmn0 $%:oDciL\.bp7$BIDELZ=_ECb#4mSj9p3Gf+eLm;e__P.;L2Qtm*JMoE;3TiRSam# cO:I6&C>XQh/J!ZFbW7'(^C<7L%Fq<iESGPB2(rHT=a)KE9?p[+]4M,KBlWl[?uWr 3_M#Khb(Nl1<I'I=1?E]@[user]_hae[/user];79sA,CG_a6'TqEp3:UeI%4"]K(qT_+FH`Mi@:jm [Tu3+&dcu,1G"k86(fUpI1e.jm+:%MoK$]J@l/3jrO^$P+*6<[Vk4<c10lTc>5n]/ rjPIKgc12"5rQ'3e77a-r5''l*=r-e<]P0]XE+(3(KM%C<t:.u$fU]AC[p1[%ckNW O^IF!T]YL[bisp9a1u3bLG$&Lk'JA:.QDnirlb;uO>OV)5uSmqT]&1h*hNH=@[user]3YCj[/user] V89c'W+N:^l"kIA6?`DkJa3>J1#4"aKXO!d-/%n'5BN(2OH.il/NF=ae4^R]i.A,m ]VQ17$Q@lPH4j,%1J@ce$[UZ0s2V(]>sna+*m6i?h&GbH#hK0Rh<R>LR/W&=?1;B: j$g!rpqB@B1';#/QJ=$JS%I?&Ih`P(6[+_B54I5Z2#,D13:`o=aS,s/,[hsG)Lb"j 9<[:hfT((/Wp@(&%G_`]N*93#kJCfhAZ\tW4HO/%*'GGlQp!J?%/?kpW't@q>+f;# Pm5!bKKAaP-2r;pGS)5@ct$c)ig(]8(i[`,N<qZ$P@.('?=n!@[user]_i]hYGpgrnk[/user])Y<N YmpMd,h*L9k2U8R%Km,1Go9>7@h'=ifl6Jb2g`PKLF=8+6NB>>K;[srQBATdFcOVL ;L*/7.GM5LpnFHJ=ehpqjQP)s[75R"n&cf/WkYXDd9G2)oEe]ZIs!HU+Q;_**k:Rs c)6#qHMM=q"P^oL?>h(ODhB/NI+NS3_pAg'iIQ!A,<(t%,c5iuFOg";](+)Y6fk_T 3.;c5MU08fL`,*o.Pq0(@[user]ZN[/user]"&9as3%:5:Bq</E..8Aa3E[VW>5N3M?JeM6B8'e#(f KEK)%qLIc\Za"L<ei&B=h\3A!(6I-U"c9rEO9B^GT@U(67G(Bj64P3OZt3\@$9Kl6 DnDs>\^BDh,pqVWKFllmp=n4q>C3WI%OraF:]4jU-bci)[9U*:0AU;'=slkfkh6=J h_l)9.Ri@<Z\16Q*tf1c=9iHZMX-.qf;%<i0Jeq*$TGQ%2RT*Bh(lGXG]QO)k*k3c LY6IN2au9KO4!/7JM/E,@[user]I[/user];X*lh2FY(Nc0dI5CtjK:U'!F*5N=RPGjsSN=fe`^,Xl ]4=+1Wa&k0Os5:[n/u@o5G$B#p.DBdgEiDbc6Ln4?i3*)lC%;'T7<"Z`eg(fW_!(8 afBJ#d/^W7N0pB6UOT6raFHq0UQ!iL>D"]jM/$t2Qd(?HQ$Hh"T+fi]/s<hQH"l#f N4o$IN^;8=7_k5G#8b4_oknPd\guO3ke'gDAf*)aOM-(L9Igq#E^a+7=e,KN!C=Dr =)P,.<:l"De'+*Ea[[)f_cbhJPC#e[rm+lGii4a[4rVFqRJB6i^.[/Teq72F@/2t$ 6U[mb+k\DCkV2`cG'd1ur@$JpU&*%[Og=;YPjQlf%Ur*EC@l/+0c;i2JLqNiVJdMc *lX((SW641GFP$@[user]0l[/user];n_c!DCqI)g^B5:JVf,e+&l.5(7i+g)kb%__*ZjaqDKLsXFM @)qW'lHl$mSA:HqEd-<9QfF+m&KGX0lF8^':?rYX_$^^RBN_JF,[.6WW5pD.bq7Hq "QfR@_tf'J^4LPaRl#OaZjqdoloiEh[O11Y;F^K\c[V%4>M9#p/eo>d,)SodA0tfh LHALpd)J/o^pKW4B'iI5dG'd$$q,`Pn3"5;BYaULM#:+a-n&DMWn:YD`;]O42sZN) '^Lg.Q<r+G,$1c\Q,Bgs$gk2i\I+%VO8Mjb4;,=c]\KYVWpMSUD>i*-*VJG.Ufnna hb*=n&f8;8I@hY63T0\m#iL;)h?2(\\1REuc7G=;F\P##W^\V&k"0TOE]@[user]Ca5X[/user]?&F +0LK-YpYN.U%sct%;1#oRG<S[j,3rD@]gS84<L:?s%kA!%m*POh-NcSFt:t6,%c2, UYY9F6>OQca&]ErKS+@[user]ej[/user]:e16ln9ah8p#bL'EY`^Ehi48nd6hgJ5*q9Qr6bVmjqn- eO571p9)kVNbQk<`#4XkfhhsTm]#_UN(FMYFN7!^;Ih$.Ked$Ye_a'gH?J8Vobme, ]\J..9$]3JeVTlcD;"04`s['1a*QWcr+#&k/??B*U8tHP'Mq(<+^@[user]W[/user]+P*6hV#QYR$ F!--/\-NCl,bP8Q/ohW].P?V:DKg5Ga6p=Reo!S:Co?*o1LFth8)Nb<&6J2Arl\i, o02(/4O<Ij'S$1SO2esX56lftZ>\!3C#&I*D=j3o6[^6k$NLCi$Zh+fnYMuBO8pRL 5___j8-8l^F8B?X=bCsc(aO$V!8&Fg0G0h(Arr)S=t+4u4tAna1BHKrP5)=&U!8-I 3%3u9:M@9?RGQU&!BpPccBLUl0#5Y%c@ll][ulAs]7A3cg^\tjGmGBEF)J,HdaYSi TYqE*E8u:SS@p;%-]j*GIP<6pDe<H%.gAb,2dRhcl3b-4l2jupY@L2VCj8\`8;haJ /qY"T"YmHeW7LlS)ohll(m[FA,NR';0oe,QG>`@[user]t[/user]*'0K+(I+>_jk]6d1D/NGhQl\( NpRcuruD,0h:#[NhJ=!4)T02eXD_*-=ES3:C)ZJ;"l9YX]DUndhBhag:[p)be[sm+ s";-;k*!cZhg^)p<kVs^MY!Z)66=N)*YH,6EB]lrkCc"slg4k+PVJHi"ZdK&6.Z7& 3.Ws+gPV@(.9$'@[user]I[/user]/p`0329[C)$dU4o+$08%30)r&d?pd3oEIXbRD)#)::;#T@hB5 c]$-D-T_$Z*!Qar"&n9[h8c:c;j)2/48RcoVU=^C?U#7U@',FCIb&@[user]PT[/user];h1Q8#S'5 TMu/MV)U%i94\[kh!p>hMI*j$c6;Qdg%/s$]lERR))DG+d;rH8J-WTg'[[UI/-B*Y ^Z&cY!?.!(@[user]jYV2[/user]>?L\t=Po@;qt2#2(CJ>q\,h:P$]&1@RNrOjNuX#:-PT*5L>:Z] U#fs_&$9a?=^&A]N:+isgQbN[R-N,8=".-Y<L,b:as"?l4lSq`7q&edj:8^V\%^@[user]9[/user] 3(\=?Wj"^:-L2<'^R.:S<CVgJ(3sjNgiOpJS?A_Kq\8Kj(B.o6PFPKE85Z^7Q;uF? $MYiY="taJ#=TAtOcm]q&qK2jo:g$j:Vr\QlLAmaa/5ZP-!X*UHZsN$G/V;K>;mSW ^2<K.^[Q:3[TA6V[gV_HIZ'Q!6!')5o,T\>B9;i%74.G\4*'OTc-@[user]]JA3H1-i[/user])*Ys *"%JV[4qKUKt`6)Cm_n_5Ij9%)k-_HR/M#4)9pj83#J+^oBS)Uf>=8pD"<Y?a^qZC *'HUFPDS`Lg)l19V\>B\(>=F*@[user][F[/user]'s,oc'GU>n$miOUL9GAZhHAL`[q8eIs-cOB@k cG21a)X?#kSK\lR[e+$FJg'/TrqM&bVlp^32hsrHP]&<3KZ#9m"Y)COP]-:hX:jtH rKmTt%AU=!FgVO4X29EJi9PVGbg`b&h8LV^&psgi=1hOdXb4GBm-1EZ,e^FVMbM(t LmKks^?7TV_btRkR*'2]Y3U]T/RY"3/=I^q%Xo8lhRTFKIch!V!tq`(7QW>'AN>%= @[user]e]hA[/user]#;[oO!E66PR4$r#\O9fPE.2jsO+OXIM`oMVZl34cC9I9s7,G_Q09^iPpj_gq AC*!mO%#Ybm)G'V`Xd'GALC./.d)=ECAr=m4gJ@*'$s*[S]"'M2EI%,Z$elHV>;5N 7La$6rT-(ZitK5/Y;@*"K##cJ$[?e(F*&be<UW%?=30RpWX\"=a(C?q4lP`Z[kM+l C]15Cir80*%l0=P]_54Sg_I1']la]O2Km^*Z@Rihm]Rc$/r<i5bJ6LaTopeF&-*C* ?VPIe?S&?tEiIlXMeSL*`mhZ,b_b,+%t9"KP43B,L'JL@00CrMS^YIfb8\I[JS>fu `?N2(N!sp_k?UI[9/)")E7%]ON/'Rp"(9[^<Vk\I_%fTt93`9qdVQ?df6\8fX/]b7 @[user]ocpo5R[/user]=\aJ6?'kX<!phSmg1e+9ZP'1e$&dHKR#`P#;Bo<AT%?Za>6c#m#*I2TDi, 10XlR1NVor<@[user]o41[/user]*)/A-H9j]^haX1s(^"?3,g>S)ZFC>.Kh\8M@:`WIH>;'FMKT26 (9"._$B#;QHm,-OMMC\q/<iht9@YP8Vq('9;u!2n1;4u?,f@d+rL,R:0[?V3.8ETk [)(q$,sZM]8>B]'g<f&]OKrsSZ]6f`5j]2J6Li?O\:F]C%E$=F9[j\`rkI87,<#j6 HQQ!d9&JYls'uhG5sH;V7%N/d_XA20f/iBdgM*;XJmqQL-rZ$5jb@f())5Ien5Q=2 Vm*W%arOZ(;-VG`R?OB?M/7*<eTV6GM1ElIORY%[i1*3d3H0tZ7Vfh#d$_"=E/gf( M-/r>`^,=lTdl,_$G\ZrOo-PSYL:q_<dCJW;CuI^.66,S.s\j2<eg;GUl<;g+=PeI V;R"IrF.8l8r;.<0%U_9i2s!bfHN9VG]mo+QDI*%-28/!JV>lS*Squ76R^0BJM_8K @[user]6Od[/user]%^'2B$lfJamlu'jP?A-5o00%2AFVQm[G@Ju+ErD,26HkK`#p,QK,6`%3]pKH2 O:n0N9#.O0l\QE_Y90kT\NVk9.tZiC97d;mqEsC!4q2uF3=H.1PGrn(`5JMuo)p't pY9URTL]?8lVO^CB2<Tt5RpP87,"aa#a%J(F[hNhG]SVg>P(/jQ?LE2ae?*):qZe_ 9]>d*\ZDh7]&=qQ]nnJGVi8SKRF\02mY!!M_CJrmS@/,CKGgN`<)kobFF&ain12e* NuXc&_+$5X,U'Khc;G9J,P6H\1E%tLNA+V1&SCu]P9;[NqR!o7_"/(1,7e+R&LY.b -:]+?ne"+Ff.tBslg`7"TM7U<2Z%7C\=Mk\aKpCfUJeR55[($aMj9]f/.%C$P4XR! ocACl[9_?,F7?<.T"(TeN15NRnTVL<"M4.]8Y\/5d1WmmQ<#Wr)uDn&eNbHjAf]M> aFli)LG;d`lX`O3le3!5Y5.`3W4Z9^D]oZ4=M"huL'Pp[,Pq;kcjRRhYQ)3c"^e"N $GgRK:.bl#_W-o6>20J%3j*P,d8P+;mPY]A'bkNh@\qM5><uuc\1UaQn(?"D15/q` Nu2nEEE!MsBENWpV8%s&H5iHh$JqWdrb;*.P6O/N)k"A-B\ZI6@Y)1uht\W2F(^;H g3E3uFoZHl9*RamB#r:i\4!gY,A=1BO^YP2V]>Uq*Jdj\0dRZ/r%/GtS/<GEs'r^s K;(EQ0HS99H]hLbR<B8!9c'"R6q%cF-Dk+DA/)RVd0PQ-L`g(*6'f3j2tjuKll?l& ^/oJd=`tTXU143WJ/X%\lNjW[(t4GW6k_Y!bt%Bq8&)CBTWuo/T?QXUkBW]_rOpOT 8$cVoAg9[LM2(0$C/Au&S;gAN'(ooR"ni)k=jC\k4S>s^S*!`jdB%-)=fZJ4UW:VS NRB^-r2":AATBZB5jLX0+oG2l!7fe[\!/jfgVhBO<@[user]8jIFn[/user]:BgGR/d;V+R^a@](`S &%Ls&A,$EQDrZM"SR7M-[P.]2H@Ns@#$\k_/a'g+oUR9M<cT/^XtM1&7Af<^bonnD 7tGSe!9-:^]g,OA/EW;gatPd/_eqkXe'Mdkg=c0t97:_^Np=ufRaD&UZ;7]-5C<K7 ^HL<>Xs*+DIi^h5jE<][15NA!j8r;s%5bF\5='Z>7tQ1')i;6);>^i5r/MH6KX(=N QpRJDl05V0]'*Vof-99p!XngNC<nk-p5C2[W5*f,i5U(4`t.m&f%IaDS8ILP;N#Rq NcklBrcA@8LgOBeRr.#:p*0'*U1]a^M"V7K>#L=qY+Y&&(8r'"NqA8WLT%i)LO)F" r_[t2DotEb1O5p3,_B*3I%3QEP7oA`jQT<(,&.3*?1(k9/D+Z!KJ#[ZQ7gZXnj5Il 1W\aR?4X=IoEWYg^Agu=olNarNHN0s)2MKULkN;,;U<aHl>.ZrOD`m/_aFQYD]7'b HMW(Js!V,8T'cs?Y7T?^6hN<hE*h/B0F4n;iib5k=IE_p(Aica!tX_0("c),?X-?] CT4cP2b^?>Ri[ZmeeMV7q6M0i<l2g0DTB>G/?Z(PV\qT]$o.fm%(pKBd'o9$CKnc\ BiR5YaRPq]E[>1tKIc#>pt5C7nD%oj@Sj(A%a!Ms_$W9mA3jWm`mDP.pqajBB9Bg7 -f/rKn2c7OKmYbP-sfmZ?bCstF74N'.a7(W!F#P$Zr_ZAFpsok%-3"G1gSXeL)e*+ b?Hr2J[?d<mih)/)PfO\@[user]\u6[/user]>nYorKE,3030[I-*%cd"W5M(9&.;s$A?81(&!:Ehr 9=\N+**Z(LCUe4D@@??\.9c+)Cp"*Rdur;"+77q/h'(/=of%HbJm\[_F<3!=fsTnX `qi;`m1g%0$1%C<R7JNfLp7Qc(ZfO':hjhT.bsS<Nh(OZn=cijIuXc:S(SQHZG$(4 8W*'pUR97mU&H&i/?p76A0/2q]0EdtRC_o0/Tsn.iKqqnPMNbo6HRdZ1=Pr_EO0#+ JQ0uldiEdiIa=5S+3a&[2)lBDbIAals,D=&5#Qk22TH#gBkuR[04\qYV?q?mJVa;b i2';T`+I%cOMI$hDQ5be!B(![28<J5Op],oTb&0FrEG*ll#15E+oPi0K6t3!:j#67 XrFOY[;cK:O)(V@Q?R?7[KHC^ZUXM_s"HM-)=uG&M9@[f=2$R-ks4Rh9m""\g=/C^ IAq$!19GSV>"F1.3qt0F&A[s<j3(iYq#;7^L[&NA=V`:<lF^fq_Y`k@'m<3l6]llm 8`Qj;05\rq0Q->+hG0cqhr"(pI^&Y,fJ@@[user]\7[/user];]55Y[&-S]r3F*TAtOhVRM:V!WEV^ :=IIbOgj["H-8a92F$%S%.M[I,6`H^4XH)RU]o&hT9\k.3[9msR,>^(0SKR8&YXZj N:mqEr[K(=9ouAYG!NkrK8[c7Ei=E8)P><Q+2BULfOu0o+T=ssj]g*tV#kYpS>dM> &hZUT-5$n*-k3q0R'o`A0\?lJZifR-g:a=>VZo:=*1makp$h%O9s1Ae,G$,tM>N#? -%P$W4*aLF'=24s.8Rh$!pi]4)n!?l;l`:@[user]cg_cTjK[/user]=(IhYo=]h5QUkjPFenVSO_: #V"\1,@[user]q[/user](,9[gh+PjJ5k<G](DR:*mI3(8SF.r,ta\SI'nd"+$2=)'7"@[user]YuaRf5E5n[/user] gog$A,(N;(/@qM^9Gn9U.G\HKq$ACW;:%13`k$PdH>gZ'$!US.#=SpHZ+QIUkTY:t MqFtUPS[E*F!33=*J>T+TY4+jF%Ai&1`DqFBK5s:O5_EFS8q;Aa;*,nXrBkJk._g\ \X&](APJG%k=%jqY+K[V&P49.qNZ)f[YEJm@kq1#VL(S6#"M<d$,X&L#V+Ms3KHJf gLi60//=)^fI6XC(![n59(MW*!A*ZN4hs<-.^KSp#0`7%U5+R6I#/0D98OC&%\Z@+ !S(/ZLtIKYn(2MNiMt"*mU4XX@Zk\FmLe(SR+4%f,g>n4[0lgcM82^:MIcKSeg<\; 7-jM)JOMkd%OgMVo/=2jI4hR#k.3j-/r+h[e^Y%B-$@[user]YI\iOY\[/user]$PjJ(PX2kA6r;i> %'gm9Oo_!M*&l[Pa,T;0B1'I/4/@@[user]iTO0R[/user]:R9IgqUYV:Os*n;X9HEt]\AJ<iWQXhF &Nb8LE:lVr"0K<u@OI0J*q6K*0&nTl>:e#*1L?/pCC:\1nJic_#6@oiYWQl^"T;4$ qK.:c0A,nN_YMj$QUU>sP7&K&A;#B/gk._o6p)>TS9s>=bki[KrHX4j_L,=<=2jIo *GS\m/L'M"0e+jJS6'aPo!14ZH4^4,3"#KgEutJ^(3#6qnp%;le%@[user]sW[/user])*5[Hq"K'% Oij?27#^F32'+@[user]rdc][/user]#=7aMn:]PO0-,IiM)(r73[D4^HPA1a4c)No#W_\]Yf,-],[ rXuk##*q+"nWm&X/&LsS4H-d6=H-!c8H^62#]ZDX\(%Mc7(DYQH;OkS$`Z!SY,=[t N]`l*_'RU3L+>`_`STB_mZA#Q.R_uorlTIAd;'BB`A2Qb_;#.)M*cr*)b&C3mk?H3 a63Q^e[O0ES0u<.!>U>-?ND'K]S<_aa>72"':1*W\J_(j^W"h`J^.b%'3)F)JCenc @"&Yo#!^Q%C(o5Z9<G+MFk*SDU[0msj+7Ka%f,U&L42C;L'a/BQg8*03>tU`qbpDP qn\M=dZWI<9D<8^rKm4uO)=/E_g"$m4r[e6Wj2c4jKpH)[%S7=3ae2fJ<3*36NVqr +SXN.YT:d9`:c2T:4,.3'AL&WM2C7c:(e1$%ZX+#6F[Iq!b#$N`i(f#"dml@]1?U> 5GOE,p77CXY_u>SWIJ,5rgrlT4MUW`ehdZ52@?lT^@[user]G9ZO6E_R5^8[/user]&AUM#8*65?Yh )GiSOl/<g?Tn'bdU.1<;&_6^Jd[C8H(^f`gh),7HA7:M)]V6mF&[&&A1`gJ/2Di(' YBNeo\A#NrLm^`MhlL2jMbrEaHL<LTXcRl!b433cJbs&t)@[user]dF[/user]#/iWm##MX^!7O2'A `Z*V>@)V[oPOo</"!>=@(oi)eZFGhHaN;`_PI$[L/O/>=msQ#XX2"QM=QL]s^2aLr 3qC`h5B0F:d[h9+)miMV#&DS$OLXY_\AL.^g-'k]+_A=9D$ZC4eAl(LrGTq&R"RMj #<@[user]jue[/user]/[FlK9]+:EM/^mA7ij*D_@HgN2qJ@Sjn5PZNec&0:.AVEV0o,QD#Z#3_Uno X^d!oB%A6>+*1LN05kduh0'ukdVKao40PEm]H*q2]2^rSoP)tQ=X)DYaj<s*FOV5H H7O?'\m/k-Bl&Msn^J,^hIa-g[\F&;OS[ha@j0kT?)Z]o.kK0[&.E_7^o*.iGG4Y" $tBX06+t)0kekWWmD<\M0TbceN;`_&oG=)q>B_Ar8N)6Ng#OC'ab-%%&W5/_%4I7q (iiAs\ZXC<N5KG^&CnbC>_^(p8pT8!TD[[@[user]rTBhJn[/user]%$!GlcuE@hRLGgfD`bT-HPMH 5MH4UrQTbgX#o]ds"]ZP,e#No^38C\2'4:?6N\?:eN!=(n1K=E>X#c$YWRjQR+77S jZ6@p.P\>c!V0765T\I>L7$&c*%rcR*?9\s^Af;>9JB6p"Z(KSQtp+a(HsdF5CQ?] =4=uJ`rr^R2Y5U0f#dSY0Y]sgXDMOn#RGI2m5WlubEA'Ei/Y6.h9f5_8)-=\[E`>6 [p#.iD52)&"\.cUqu5l+mL9hp_6nuc^Am0K\KnTIf<flP/MYPZNRYH2DM'%.ZheYU ]F*48^pi,`B5;&YAp'4715VTRAQB_VF[gcmhP`ps80/J"oFXf%k9q7aU68hoXK\W] CHR*"HMrb\8L.FG3bTS.h8QoUH]qs/rp'\(@[user]nk0iiqoT[/user]>li2_2pejm./(R:M_nUX] e)J$tPdjlMD3sd\G#ZYKos=l:dM?4<Dd0m$!r?mr^l/F2;:D&QS+ih!4aL'M%\E'7 F9?n4*#\qJFI[JtQNrC>;deH!Zq\_7mARnKTTdM+A4=q18A+56??al&VS1N`,3<?h $]em@0bn"H9l0X<BGs(pRXnu'V:quC$-*;X`sOS([S!RFB]C/>MT_s+ZRV#LpeSnV H>p,Hgcj0Ckmj2ECUd1a8mTXA2`Y#fG@p7kbn^TeM8&kNi&1#H/[3nakW2uR/KBH[ hFigV(1++$kp/<`XAW;[7-ihFO"m`BH\1IC@cX<upZ2e0Jcn<DB0Q2TP!$!rfim@( TX@t=!c)%8Q_pe'!DCmY]1u]_A!dmpk+sGTbN$C*/i^qK(+lWC!m!9,Z=>q>8K1Ij /e'Bt[M^1l/]d$#(!SWc1u!8#+KLnF3WmV]Xf#s33FYH-JHc$e3qK7DT1u+bPDuZ# qY%d4?A6]kc85El/K%R(o4YCj+ui`i]7-2TOY*R+:P9K1iA>G>"n-S#jeYd6#*o(A $#*3l,ug?*Op6A@M5UQ6MD(6=)i(-X&3?bGS=l/=[=qQWOY-<Jl$hFf!.p[%j8n]. )@[user]J[/user]&[f/]Js.s@!tNkE["T%V\'RQ-7^eI1^qj'7BQe^SIu5pM.!+pUSnl[EqQl>7'[ a>#S<,e/"_=Ss53cP(161*f\i`[o_>CXtL^OVUY@MOF7P*3.[uc@)$R,7kA"1p_R< HWM?7n%$gY2C"-SUlU_I00OA\kn/b+(_8`r"REmJk.o`Uakh(#o_PqoQ]ZT#W&A)t bpcZ#Zl4eBio7*eWS!:VI*uTqk6lCP'8#_Fq'/g/ZETFs>Hq,;;K"@[user]IZ6hCYoj2Ag[/user] ;f<t`pIe<3?iu1Q[WPDo()U?K=#ELC1=u)q(TBbi%9I)f@9TfDmnR!6e3Ianj\A\- HC<OBJ#O<*,Y%DO/46>q[$s#$HDW9G>u27TbV]i/hE$_"hkEbLX@f(=KDb`J*G%7j lJT52mh=&U?_.Ll4.(1l_*Pd;gIVqH<41GYPA#Yj^:4LfWJfAS(l`r_O<_^r\A+\? QT%bVflnqcC+T5N56gonCV5*Bk&4J8Cbn&M8)fo+)<Ae)*0A%7/eALBKp>mPd06SL KlP^1n=]Ddd"RLl>h7hRgrY/?^pr]AfEK0#g^2Wk68ND3h2f-BFn4TImXE!Vb>R,( 2/mrZ0^S'$RG1AqLhOJ@Hs[%+bDTTQa+s#(B5)?o:[;`.22pCjCeWhC%7.Z]CD8## ?F[N@':"]=RuH3eBCnqa]nq6fgM*.*<j*bD!lmP_g'J^mYi8-!.V^i>2iYs@jH8=; A*+YAgdM3Ph70?\KV+in5'e]]d]Rg1<P^=J(EYb&.a?=-(Z,5S*-&K5>##k#XZB<3 bUo-7L'R2(r[gY]"WQ3Ogjub=8]]tbZNP*.1(oSGE%ND'Uke$O,Xm1T`SuoTmO#EV _gLQ!dDoNKmDH)775&M\F%.E3-.A#k0mSE&:ohm(ji[1IP"8`b@7]d#o?7#G]`PYq F?!&tI&f/fF&+bm^+\O>&g:.LU?q1fkT:'>#9u'Jbq'l3NWZG^e:k)&fC]6^ZN5fl N!shh)!Z.he4"u6At$;+JM)sj0_;Tg?[OgX,?Odt*tOtQrF+h3GU3j6lggKmJrn37 66J6^N6-_;L_TPYK]kg=JPm'+>j(i>FdW=)*c,F3pA*r%GH]7AJ2r@=m_DJ2<#2PG b8N'6MJ,f-$L5T@rM6g0.AgltNG//g]a[-)Z(0jS,8WtH>A*QI.^FNoG5a]T0DD-: Z9+(N20.I9lI_M?CR>FoW/J7AD*+n<\*d^JAUT*'!qM.0K-85s:EDG?JKuMOQR%5s GU+Os_b2\>Xm7/R:gmXOEFib<=m=.R>.+Cs:-0iPPKrfj96g4[1]&hE3PY1_I=L/C k?J<*-sZ_AKX8d4ZaCn`RoGR46.2Mp*%>V:.9c3A8"U2?eU%8Ej]RFVUh%!,Q$lp> SlE9tUstl>l7p6mOY2R]L4`#P]0"-*dh[9Sol<B"G`&`%YO2>VH*GR'[T%Gf*<LT# ;hG;6ck#<K(AA1O..)ig3)PPmX[Um/kEOLF/B2GTfXK\o=@[user]_ic[/user].Hgjkqn\9)<iSqD 01=EU,Y4(eWD6l?DN1Yd@]F7-35c9Z-@&,6"\$kA9>`LEWU?]L7%NJ<6mq-M?!W-> hV?Oq8'!NC,qd%I=5fMHs5Y;Ro!-,IG,<4pZUr)-r8/ol*Yud9p\4Y,AQ(G.VLS@M ;!*"m9hC?meNHRY,f\O0L7bOZB2^"lZ$4Ug[XdMO4%ui4&-+S5=LskoC@%4W1=#RP WgFO)>We5`ibXMCDBSOs"N/p[0di.E&i([7q2X>*q]h0<en\ZoV8L6[:i2go^bC^. dP%C'jZ.uR6-L.A3JBVA/[B\V)7Au-6J$g3`6qfQ&D5uHbKpK;gqr&7OeRr[+XDn" ^,4@`m)Z;-\PNZN'"bX[[BM56;N^l[g2Ph\W]T?qF3"'-R)Ibq=!uDDdc,(Z76GqI Z[me!U#-Hlr_<1:YJ=`k3!bO'1YcShQEcHC%m3e?jV*qH7CcA*5*j%Z\=RQf,k[7V 52d%HDIT9$Zi!^,Ag\H;Jm\`n0KW].T](]tmP.kHgM:SBl;=n$Q^$QYp_U\,(j>WO &#V`0^:SI\)rB`Wr7WC58&V&Fp2$I!EF(KiDdPY8M*Mmp@:OVBWt#EV,iM5&/nERO aI*&JH!h^"C8)<>At#a1h9S`0`4RS16=$5d#Gj,9$fkUpWEWPo;RA3*n-Ptre2"Zl fh&5GVOq.^>&t3XR1,3APCRkn'CnH-?Oe(dM`?*)lLb#PjO>`!ZcD#b:;T`K<G^ZG G<o%MWkt?AXPrk8=5bVWKgs'_Z&e2WW*"1l(rBFM+kFaOBo'MbSQWqjFCq32`<JTE .n:FTKQIb)lXR6hrst;be$s@dO3,Zlh03>agZg+&`#]J7MT@FqVU<r25<:M6K!':k 5!(7]Or@/r)4Vg@aC:uinYcZC)HF#4l"2HJ^1kBXg6$qV[6?G:/\#d=O(o4##`Yk; Q=WIZHA4q$.8f)%*K\.o>]:&(a>@[user]bH[/user]+eOlO7E./c[_peJYAu,tkqV"\jU-I<Q2lIr Ug#1XS41IS0MW^`:=(D1%Ln*!\Q]7p7!ZC32rrj*hU+4Q"nX^sPZ^Y9#adm^rB;h^ 1q7m3_CO7(FW)9_G35_[`]m'n3tVIQpg#I0-X(cJk%*XAFViM`Y_<oG'hOO%SG"He WboFn9PlRJg.9[-rY:.pjp/,eT'"VTM^p>`kMrjO3R=eRBIFnR<3hDis5bu!pEQPe NeBh@3B;6EX%.@[user]\B6g0[/user])CF9(OH7alDR_hkc(OUOMnCeH.D.]%edPrm,I.(7M#\(DO ^UtDq09^>Wr(1R0+C%,?2XnLdi"50s;f`^X%+eEX]o6U$Pj1RUGY\ZjE^>nu&*kVR l,\Krp]A=k3?J`$ef#JT/%_-fR&Y-&"--_LglHGWUru%`>_6p>n#^u<KuN#%:7W>D +GFgFZ)5")PJpr^_I3qk@2HrB'(mR-H!"Meq!Z6_N$K:`E#O'4Fg`S9L/0s\jD<nq LI]Z[*B?+tp@-JJ`%9Xg%4PYMA/o@4Z,J'7@S)$WVBhLoVqU;TW(@[user]u[/user]=/emdA1uKps 7rtQ,B$!1a"`Db_H^&b*a=r;j$^2bF%O"Zu/$J%05Z*S.OfB%%:_Y*MF<XQJ=9:o< %1N(u0til#7\G"P82MPfljC8=Jg-]cA$:1d..oW(;B9:>'jk:]C*,+1\i`afHYZpd bfeS*oD6YbY\>[r?F+I=cb2-14XukW)bD+W+&BNjrGd'M6;D3'Y2.oL0ia[Cb^.uN d*W_4'<_cJcQ#(eI5-L:Pq6`oGE2>L4IQE-X4o.o0"7^cQF)&`GA+U/D2%pkE`HO+ ,uR8_RD$BbXXbVWMO7S&UfLot/1'_Rf>kN&C2'_`881e9U[3'%-@[user]Kg[/user](ZZmn3=C%.o S?"+hasUB3I9H6>SV;f%LT"M.OD66g]^L2Z?>n>u5:S9J!KL1Wpfl885;%,+%S=pO DQRgJ?h3F`hDB9)cHs&pm%43-#C,/l1X3%;b!FV1nQhQjJ6/]u<>Fc64,&d:L!uX" YL.sWH]J%%_YCCoaJ_n[Nh1Ue@!(`f]$pmZnuI7&^[9&I)b.]ZP9N':'&+DWk-C$4 Ds?T2+4G_f!A<2/3SjeFQ^0!R\U6H0N\H3%@[user]N[/user]"0-<1+mP?V;i%jed()VQ/,mEF#Z/ 3YF8`=`WNA[%=uHhum7YS`8B$RdK@!eb4!*K=Y.K:_(Uc7EWg<4+;n%6IPsF%_s[F ,ndcdMKkR+DEOkWXrr<,WXSuVPqiI@@[user]PkaJeMO[/user]!HoXCpUY>%K=fq1#KCA!S?_.%W1 Ybo6E244cs!lCHB:IolT'?8WZcI4Fm_IeiD]p7NQ2c&kt]AjsXo!d#J(p:8$^V\.\ ?;Oh%4Gun0.kCr&AT0:=r!e[MbD:hD7OT&2HF0j6*;I^O4c;Q(rZNK-=\Ouum/+rq \[D^-JR3$gP_:W`'s)%-@)d,`\G@C".E;jC`/S38lD(.G;Vp<H!V0[C<7'$Kn=\\o A;;BCF(kIRWsOjV&RI/kf]FEkVi(=uU8kG.L%*rL>=`MSLNjR'B*e#7!cs^"FtDVf <5i=l2Yd.!XrmpN`.NjDlqB'!]UJ+]opo8Q5"A&8J$TYoN6';KlrR-'rl3+d>KHX3 X5IoJKtj1M>q8"55:-[M@h^G'?S?2fhn+=hm$rH5ndTpf,1PFlVT[W%ibRWB+,>Ln KS91J,fFhi@jFa%nZP6qp15Kp`Y@\;UV5HTU,pU[Y3i;192*CjCl<YoZcEttK9LIp m2/3b60]af"]HTG0583Mb%966]=:r9HM3lb4_Io@=[6(AK%pr7_3fP*K'?rKRODYm ktIU(dnD+%b[`&51M;4$o:C"=0M7Q,cp*'B]\iJ\4R_I.X&/;P(IQ(.\7t"ao;Ug7 F*.$"IU_hDr4hS`U!14Heg.a%q59GK-1.>+7#JL(f$*TTk3oa./85%tcL7ACEW9.7 J8ij#2i.3Us8G*!cWl^!diQq-iu6A11R$?AMf$p7N)(bqAR!W'I]6.DV,YuI7ho!g )>aZ=C';WaS3,2AK)ZGAO$kB3+!ps(9XA'NRg'(!N3Y^nCn[cGAg.=f'-AN#745#@ qQfK!1MpB_0ELDTMg"*:PlFJ%2%hVOVRUiD.1QBM/;riT*noZG.5[jDB-F=GAnuQC `\2=Em)m78'2Ul+!hVKIOpNNb:20(Q<tLKJ*Pf]Y2q]]IN8'pZ@0d[iLc8^=h#P:) L,Qta_)9oaJHn$jn[KmZ(L9r4F89cHf7&3f<k+rd'-ZU^r'*bUd4:=u8o@AGG\Oj_ -.MTf?*atVJj\)i06Ya\@>n"0gDu5p-p&VOm%=_Bh(]]J!.N(/>?9M<KL=pMmEjPV drLo3JG*\SN&]H*J6RiHB+"MMI:eQ_>OY7VK4Ce$S.=82l\$1T+f"54Ymbirm[rP! gSC&\,6h]4Lcce0]hS"*l,IoG0qpj&1XLZabgdi;B1)SFU;CQPlinr0cC;M*W0$$N ^>:U3hgm/@P-VsA"o,YVb-Xp!L?A!Uc(%8u>0^b*I+;-FJ?N"hf;oAFQEYnCUE[F` &\c7'LR;BK?bP0'J?OofY?(C+,+nW)9'5WN+<ZROq3j>E?`u3rePkuU3Q4-)RlH.s 8j5C)<)?[?.^*Z09sub?%_,C41RZ-P;_TnC8?0gH[:K"t;X&JmE09+E'#V2uW^MS[ 64E;oP/8BA'I"/%P.JP)5uM&iEGOY5"<HV8age$UT,Zi\]gkfdWVd7+%'Q<T<YKAZ 2G[5n>-?T6?,I_#=J`':l+%YHr+Ce%h2jmS^SROc$hZ@c>2RcCB(m9&n:bS9?pnT1 s7c<@"$>N@.9+(%@[user]C[3N[/user]!E30ThN-a;3XLQW2AXJsb;S[pe=]/jTcZ,`_sX13>RN>u -<3gID(G7rR?=+uY8&tY>X-r)\NiBJC5@rd4Ad#j<2)PZ,;_m(a%W7,>@&"oGu=Y) pl[7TT!_OOJ=RnZ2hBVpp2UUK"2mrk`,6&,7)Z7o]G9c;@[user]deAIUK[/user]/<F]DjQD.1poP PgG/E8Rao`HqPaY^IcAX78.)i9H]3*=SKT=MY<:=Z\:Q][mL5-637Y4'CP`H63-#Q 6NC.$J3s\%;$56O,H@4i+?pteJ@tDl'EALC;Kc?k'CZ()P&^9&=T"E]G/<h5/V6@O ceb4]Jo@_^]IZ:3^Gi@SE1'`oPDpDJOgGAFHTIq/')pPGZ'QDKI9kH!-,o8<oif7O TSt^u[t@scX(X@+aQNn"V"ii0F^+,S+rs'n*?sc8&Y1`05X\qm>c+7&Y%,E3Yn+Ak A),4':LhkIY0nA4gUj$o4^?HI5-*8'l81E,\^FU-W>e]'h#euB$ioVE[?n/,p4?2s JI@`10AJ#r^rGD<#WHh-??;/-Wg=Q?"0A,2D/uMf8?od7q'8JQ/<3\!IMQI`*2uY1 [P1UO3h"Ge3Ba<G58?[\f[%ZUXl@V@9#!_Er=&49,$hqQM:Kpg;XMiBqa[+T1Vs$K PE0_,6Z(\WdS<NCV<b977\-RDW?&0!fT"EVS#ahK_p09JIns_5L`tP1W,K-TX,a5M p(g]lT._)EJ,HM*b8BtY*1&b+DBp;@[user]kXN[/user].!p#=dm_]a/T0R!$1(Cl4e>G!f^7.8;] #l!&W;#u@'`:mXYD&0RBo?JVo0/hl+J,").Ekq-<6bVMa(0KM_X!JF5>@[user]0[/user]!BT\:\o ?msY-(3jBV[>C'q]5mIKh5`m=2pmDoIHpgu'XoPAq4FKr`nF#X<Hf9M.dI6;ZPmZ< J),j8X5E!!T$Uu,F^YsS^U)DfpVVU_6"`78Fi<JUFdIA?nisb.X:b+9'E,+=f7s3a Il@:E=M@poS0"J[q4dN-8V6Olg-[B$F&eWhg7=h-q=Ss3]ol*M@0iIq@oCgD3/4=o GM"@[user]L[/user].O>UDLXhQ#'nL!,[9NdZC&uXA#Q*95*P0hFrPV:@[user]m[[/user]$%O2tF&?Uh=DSp"kcX jQt5(mVA3]X;f6e]""#AT-:40H<.(naF;!TB$R^aP%UW%B^i*Obe?*`g9q#EWu--5 9(8q][^VB323Aub6!k24"`<1#SoMpTcWV5_K`TCaO'48as*Y8jKLCRV@q`J?NG9Q? h5[!2A?9R]7>'!6?bTp[U$)G%Yd9*9./rOf,j[%8Cf-JW/c;F"6J>#'_X=h#$ehfn f@jNrE'a8`M[:JM5oLm1El&(@[user]9[/user](\6Yr;@$>n9_]55/k1eM>ujO;XBc=7*r_A<&CD% O2j3!pW."@?eVrpW$llQKi`0Kr6lsZX6k`ji&9'`m<E)o">KI"=f780e.[P`5jL9M Qm%;o6Hg=;rDH\9mm%#NU!u=](90utFg8Ng5p2P7O^Q%:XH@17*+8Vo@*20=`fQe3 desGZ/-%ALI*hUXgqQ^0XOVcii(='Vj28U.G%F2('Jg#J)i@u*gA@QXjM<a(k7,eh /+t%=LdeN=(UJL7g=*IUW.hS6V(^5gU`%98%nbAib4!-s]!LtZj1iaLrhYcNkHZ5[ jq]PtV!.]kKgIXX-o6PQR/',S&b,T5]U,,s$nrO]HqM-#R&q!Np6*;1]d]F)8+m=E Rh'a3fNX:07jF?MGBnmn(')[]dB=KhLUDaV\]-b@K!<L<;-/1a\(:p.!$P(H>satB J'o'NYoXZ2Gl@Gqgi(a^P1s0`s$flRW3U)mYeSk8S0%:WAtdn,qMW[6,s"cJ,G=$` E)^c(;;L0/V!+c-i2A;S.n)t1!(X_8j3A$mg0?l#^/A%8UFNM8nQ\*AFScV[WSk[2 ?EO4K;2p[V.Is\/1kQ67?'*%baDr>V3a5"<H]s?$'\_O>;%%mA'H-BC8-XFK1fq)% 0lfY>K#ir22Bq>7\9/8`&W6AI-KQZ"pCp6Y'7,u>s-qbk3ULtsEiMF3j43CD+U'Vj cCk.7hR>EuMVBCt\V6p*s-P1l@A"CTV8#sDn4bN+EPFC#:F`C"C<M++0,LObXuhZq FDu/f9Us&(J\.>^7O8Cnpd4MiVu]bi![;RK',@[user]Y[/user].rRcfmf_=46pYK1`=a!r1pRB;m 5b"]7(.^jQ$`t>*g/4rH2OS_LF4N?^VW[A"ehjAS:8]oH#BoS)GJ<8;q4)O@$Bs%/ [B$La*WH*$[H%5FS]QhQp,_1c7r,+J[=qiL(#8kJd55tM2<@[user]f06\RY5h[/user]#8pNq/^5K C5-9'nG!I52SJ?LU]JZEi*8BC/OK/68/nsKWWOj'qS0ML[5L$;S'mn:A/0;q;DT,t -6"^DmOR#<os<q^^8ZGsobSF4b5P",<]Y_g$_-2E"X\/6'36tu-$T)]'PYuH_Vi(R f@V6!D#^L)BkXW7U(c5jFRS[;GTZ&Z^OO/u0SfEth>8m]q#/S:r*T4YA!h#Wc#NW0 *4=,[H;I+[mQ+o.XEI"Yq,84"f[R9cd4e[5r5PPJ2i467k0d4s1(dqKBIT^\6[bN5 Ej*tL"+MTM\m\NJe>CULYcHCPq_&S+B`>ZT>8MP0)u_>g#dF4PNL,qWlAG-.7uC2! ;3W`#j_00g2C*6db80pfQnX!`qP)SUqH[IWnomsSYBRAOkSa:B:SpNG9-aI6o%XE0 K!sPSZmh5eMD?1UXjG,mXVFPpoO!fl4;bl[,UII_Skk6L"7*4Le.Y>qiQ($$\S22! KL0p@4O:Cu&6-AlU_,rn>!>kq.d/!NOlr*D*S+#/Bo/gI)[5rI:`Au,NrR<JZUF+S @[user]J^RgAF[/user]+Q)3,6_g]97to?S&GKjPLFb?*G`%Mr36NTI3Mg?+NPAG@<<MDWBQH*p?>p S+U0oMVO+9L6.NS&QH!#K'jlgIH\I//KU`&-UI2/=@[user]I1Mq[/user]'Ek=VGd(\K2L/Dls0Vq [_'a@H]E\l?o83S_;a"1#B`JFY4Jp*/.jDSPH(r[YWWZ&^u8K=T?PDG?h9tnN^".: Y[ga9<++Wl`7T^Y$TA>FBAtQ,Thu(I+!\cp)b5Q_G\stp]/dn!X1hrrng\._S;>F% >YJuS@`qJu\n2*M=dp3Lrdm)S4Jkia>7JA<Xnai"/6!S1"R-_;TKC-;ZqQ?h;Ipo( ScbI_gFO0*+f\H=S>r<$dgmi8r0$5[?@(iR;TFc./7)3Q)n$#bR`=G:Z`o$DV+O., FWr6P4dQ:u*(TVE[!fd"7Z[??LP9R%2AgK3S,RsN!XL0fkN@drFs1L;7B!"+FdI'I hke1"b@hPf3bW2U$-PB<9;$XsEX9["8Ih%8W3.FW@Z'@[user]EZr4RXQDa[/user]%+h$B<hUg:'k FUcdegnWOnX;<n9>*>dG80M*d;L8OgTF7LU$(:i#N(\:6Vq.+Z"8We?*uTsQ>/ts] \*>?m6iYY^%QW*]_S.)AbOsZPq3ZPbs+H8=K:0^%:EH>A38O.%JQ/uF\:R%9^Esm, n3t&q^!V">.bd/df23d,X*0.!C`:qaG-?C/'R^cKkGrH>/uTKDm'dDF:+9c!YKuD$ K5MP9a"!Gl]t)XpV"b=tT#>Yfj@3tu5`b.\9L47]StA[g)0S:M*^%M:LV&SWX*7)j j5G=e&QSD50bm/9[:i>DRbAXf;[>SF/M\uor#FN-Ig^J!$&emt>9>=i-=OkAV<G6e MkLCD\RMmH/oau4IM<#L,FE0_258rhgJn*5R"=oL,,57Kp?oG9]rrLunVrA5aG(rp kiq^t3athl^ZMpq$MG5IM$<dW*u$Z>opRp!egjNdOnIjn/@#olfZgp*e^<LdA;,XE HL4CNgYDSIGi5]5i+BD5WGS$g5JM5!:tVI8__/;2*Ocb.g5;?R8rRgAo3SH&**LKA hJ=q%PPC8fV^sP'^13/&QIl($fh=;>:Qnn-$d85NTCA/4X;ZHn4p!7Z1gX5.M+mkX V-1b0VulYUdN$d3hQ+P[F6=s[2=ZH3HNO<nj+9UE,HbCed.7u\Hi*].G"1rg8SAY' g!^tT0d\5"C"n3gMU"])c;81&F>3P^qqd?]mEpKW7`Qfb61J)XSIPP"UL3_FpPh%b ;T.eQgmTaLd>]%*@[user]`2rjkd[/user].pD;D-.n'%c7_'j/@!UN;@[user]ag[/user]:J:fDn0(O;.PNe4](0L FCpf6.fhC$ZeT*!,%$9Gh2u022^1^m,=Yls7SiBUAYA7>T,GH2;QE(m7XoraaZU_i UbDCJmFgC95<T^_3Lc1l;J4pp//XKMVos8+;@[user]^P][/user]"4:,sg+amC2E.Ts"i!4FZG.(0 j/k#;[Z1Fj=B7cKQBOmRc#o)3#cr?-07)_H=+'8Dn<I7HCan:l\Z7B&F)5Z3kdedX =3d?U->q0#S0.+b1OnIG!Brcp=bLE\WkJbBqaOSG!&'Tf`>!8-_c\r]AM`q5A,8(f 7)fFJn(i9f>&Wj`YladmrTo.Mp;+dV2n6^g\G=0tJ*P7ER$-:!cGF9>(nD"`Y*^3A >$Br'S4&!R1@/0&6_:Jqp#%h)&GV^(_3;EW4`oaXY2BMN5W=)4g+Y`D?ZE$3Y/C`b fGkJ8YdlFRnn=*W.f/]FI/#noB&RsR^1,M+k_cU$W#Y9EAfiB4Lrp\qiVC5C'R7Q9 4,t8>WOdmTld)cVkJ55S`l*MOhFP+SSc\%7)B,c`j4;%q%_$poOq$5894VqFnruL\ >&PB1PM`,jBkYl#$6%&)p66-4iq]"nI.](1#<j,P/SV9mDn.MObolZ3$;D!:]L:rm i9A#4:P)&Oj!l`p`7HX^<M4Kh]s0c(!n1QqWk]I<Y3]69ifsj]m2u7`Q;Cs4S=U3$ +8nat[SrXoj/+o_Yhb>:>PbYi.a*mGVP@A9'kKt(nWg!CnD3(eflT#BJ8<ig@cW:d gS4JP6a&04$Jr&qWP[,^_akO%iHi4,;bidHS]=/3c&l6jgU3P(AbGE73j;^P+`3l= kQl`'aIe.R!kA"=\Q0QDa>s_G=qO'C/lG&YV;aLp'j"3X!]g#jfdP5q(UtJ@'NS== Ml'?U,O<Rsb$g=oi@NS%lAp$?;[hfudS4EZ8HfI@Y.eG,R$%^t&&*5qbRfA+%bmpC UasC:c6lL_,5-63bJbp1lN#t>+l&JF0XY3oGMB`\W(;?6^/>mRUD60A&J.?!,"1Ot +RUkC?2!Bon(BY($S$(<Q'WbJJstXA%fm!(Z(5QDJr^eM`^f>ggU$N+SY!GaXYI8J [XZ+VpH.:,S_mMG33's)&Y4\X;85_ZhOKGo1tUPYNpQ'.`S/stLkre?YAa/Y?DAZ( fhEC&p`"5SJa;l1#Gm&=hV\AHCDb?P9\+[bekj(*Zgj1C\f;2^RnK2CN`d=.]o#K, _]t6br._Q[.klN4=hY#L.+\X0(gX"Jo2dJ21!.``<:_:foq8Ha@Pp"<#LT7HU,K<R *$\FB(-L`F\q%&>WuVAA"?)r*0[4%/)DF7g#uJGLnI5^e+3$Z%%0'j\,nCZFYmD(7 *[VH#(<?B?,4ne`QC!i#7AC84BiQRX`]S<15hD+FfZc#E^%ZNC?!L'="FM5^,N)dB \Qn$K[uOnl+'?91@7O9rcd!Ig\p?j1S,W$:Na*-I]Z-PjR!@[user]Itht3pbr4Vs[/user]=l3\M2 \X%*!jnQutNUCD!,ee3I[$Ka#=A'V(-`pt\9\ef?CjAU2IJU#e,fZ[I`3=klE#]FG %;?V3@kkj*(c@T)ED0Z#7hfAO_l$_^M@l2?]T5RXbRDq$:s"Y"k1FB&Y'M0gQUm!I 2*XTTKHh%sMhG2kFE\a^#kUS3RYbW!T.rm`n/]$<P%C(UN3KaVgT!l[-Sh(af&rf9 $Ke$?Op@^U4#rFheGq0$"G:(<`CAoqJ9rS=ki!*R;n[hVEG>T`;i>W@F<ITdV.p8I i,YCN&Z6.'"/Y\GY8Z@t-'M#qbHQsGM]5p313WP\n@foen+?;/^qM,0j4de>ei3P[ dB!W7'ng1)rA4ENmW]l\MF(rIoHTu*dj7qljYXDb,IVR&&Fdn:!fUQ>%0G,Z)XMo) li'\aqn]Z:$QSDjO&_femP),0"J"M)]U3BWpJN0n"E;,l5i"@[user]bJn7ObEppuVc6B`[/user]/ MCEs$GaS;h(\3SO1P=&D=.pH/TBI39d4%tcr=OiE79NY1&;N!R(U,MF9#)("H>nD_ _jT@p2V=[m51\i:.U4iCc`n=]hsJBBYg+:+-4snn)Z&m9ptb90`Bid[fBnK(pWZd[ Msl<@[user]][/user])`PZ=;)I&2aDlbFjC7/a4E1ibM2X9XAO@L1^s-JE]W>oF7UFFEB[5N;mF"5 50M+t!l"t+4sS'U;i10s+T29:ju?k\5l\f5!;29#<;UtDGXfZdQT(9"`%'t>U+s=j IGbS3hop9DNHOuQ[;jjT^"D.W.t@M9gl:@[user]nWk7[/user]"V1t-*afOqLXl\k$K:#_)A+02ad \GcRM^o<Moid>SQRZ2JH+H>OJ$5F267,bYKj,2eR]edut?6#>J.s(BN#iiJEE[SoS DWo)t^@[user]C[/user]*kh>#uB&%F9U5NH1E(9'l$;&XFb4@Q4S"tN4(PJUkOF6NqP]A#]PTEX)% (X*itlaO?XmZl53$;ar&21!QJ@aFo1[@[user]KMIG9_[/user]&IWaAb33dI1,)Ul<Db=?OaOdG)u ^[1D,_p%\qD'mYhi968ai'B>TL;@[user]g[/user]<L:D9M8>s;,.EeWIA4h"j/=3SL<DDm(s2ca* [KQWo>l]+q5k4M-32&+@=?,bSN^MHD>MGis<&A8ugjmAj6k?=YY@-u?:n1MCSKl): K9f49P,lN:'H:%!'GuAu`?C#i\]7U0*c@/s1;+)!`ZF75OC(dM*G0107aEE0)[?Sa PcEaS\\n.=rM_c[.j;^peJGqK/ofp[hO&)nmDd>of6na-s2+Rd9,GqCJ'(+N&ff0= b&"DTE]mCV$YZS7W@qdiW!LYE+@(E#_t)Y#YjBPN/'qP:A2+&e$M<$HhrK*GE.0m` <7#SWI89CP2J=<rFm^=jk]ZL2c8\L@EgH&GXJ.$)2S#^C>tLE@aRiW-^Qn7:[G_V\ MN<]V$5=U`+im'#?#b!:f=7+Hc&Fd^CNGJskIak[jN(+g<>$utEjfV0i^Wg5c9%Vg TDe-S9P,4qV/G)FoV0_C;6/CGH%Lc2G^c6QC:&FcUJ88=ahcf*Dr/,WH#%4t_O%%R SHDufDm5"`r]FWBnqGm1BK-5LABV"tgLR3srh-`Ykn8i).0M=qK`!6#N;02g;dKkS Lk2Q@\3*h'LhV:UU3Wk$-$dbq=J)M"6&Q4:%;='@[user]fuo7_FH1SmLf7[/user]'U8qj?+Mp\H` C=*rF\;F*kEV<d[$@[user]qtF[/user]#?Be/A`SeL+*[?r-CWa(=0$@[user]ff_[/user];beQ%L<icW0spHc8/p :AEm^[dK>u(&I1-'6dVL\33%+$4G`\a-Tq($ktRe:HpL!X1=4"H/P6J+q4sQS')ek d?cZBr6W_6a6baNE"RP"c^a)6@'QlW6!)bZc1T6NdPSD$Qa,(W.\n=fbotld(;kT] 0nO7Sr,ea%]ITK)@[user]]jnHR2`O[/user]:HK+oc3OktM12>Dg>Bb39I501#d=[.elg?$bKZ#HH '%6XgP:9bt&NU:-?$f@G-DaElX[_='GB6l[%HOC6X>A_*b"LBC=D.mM6BBJk]gNRi `\.o\h,8H1+'XMuKJ"ZEA;)pM(RF$A\QGO/;aNF*.n(talW$?U:LsH2^;o0fkG]4= 3MQWg/G'MoYjQbKmB?tj#E0%SSE8XKLE*&eW@@[user]sA-4c[/user]<j#q=;N?"pDqh&j*RI#s`* kO=8+r9CTt2G:<W\<m7cK>C*TSOm]n3OA&'>8)0%flB>Sf5\+*jk=Z4oX-c=m--B_ SFVkRZ<H)+_Wo"aEb*>0$plDk.Z__e7BSt4\tRJIlHHRblr'=c[Ja&pdnP1s[Ig+B eKq3kNN*&eLh\2'H^[>QjsbseV*aOk4`dDueK?c7ed7na'*kX[@[user]PW[/user]%7!BIOaHpgA3 8lS./T!>QG$^^>loXK$SB^#/dmtM66TqO\UKK!1>RF"o&S[tZ'MeK^rTonYL8-)p! _imsY9<1`F6*[2KSYbH7/9Tmuku-GBb)T421>,5;d8(,=_#+H/jVAT]H,Xb\%Wde: >\Q<#cE&mU7+#C"-?oOp]TdY,KqNsPW%h[1Q_KVc0EgNe3TnVS6#HcQ%)O,0!nA%) BYDS8&N#?$MDc*,=YWS(eXDhCZ9GQppNL3\0.$!Q+8S#/BD13>rr;`m7sP.,RRF@B Xbo5!%i.m_WH.-EAln'$%2djE^%Mglet#JgG>"Jh7E!tr&*<r3k/$fin;m32c!&p- P9!Ge@O#7:/OIZk&j2r]`'$)pA>:otrsY"T_6;&sf@8$Paj;OdTVh"_i_oT-.B.VC #jLTs>L0C,9%k7"I6+Y5b$RnNL/AqBS/2%7`8Go,BCF$kYL'X[)cL%5D6IIQf3ceQ "]W$%CFWeU^C%a"TNaCE%`o797J=`Gr>\r2hoI3(Mk8cj4T.Ak]gJnIUR7&<kYTgh h7R"1CR_h$P^td_<b=:[&,/`A.<C-&jZ%9b##&m"rk7K2</%`["Mh+*5H_!@>j"%$ %Bt_M,4Uk\E!*d>*Nb/U;N#Zp4-es"F7LZW`k_+*7C"X4%?DZ"BS7P50SBoRU/6rX l@u%66C#+aQM9mq,W\DcZ7F\Zi8E\k4&2O/F;]F93P'qq$4b=F1`)FR<lb[CmV2HD YD]Hd*&><`;A\b0Ehqp5:!tJ-e<Hb/b-T8!S6(RsB;8VaUc;MEX%m;^)#$A.-g>kL bbjdr-D/uBgN2Mq.676PkQgs8']8),2^Q1Um']68nW.s*L4:ip-V%+__L2JalP-Ph pSM]%]L8kX6:;57^iBXYL8(<PZ:M`6NrrD2[!m0LOZ^1<*Xl0siGo?C^'sop%K%ut V/Npib*W8K-R2i:))US!0,a]sGN1s"+0Oe4\4r)_(Y<$/G2XWuK3pmAH=r\&:A51) 0;)6*c"FuanH*:Z]#D*OB#eg_]ZoO,XE`BA9(I%VHs&ck"?(sar?T\pNCE.Yi(k?O WXi"toUb9d_f_Sl']8:55*U2bIh8c76oNdf\>gLUdoSL#c<Chf>h'jApY5]g=1neC 8u:P=AVo/d-koI?p@2MBcIs[OM1/1fiJY4.m+?8f^DBI(fhq6L8"1kfZB-(_$0!5b f*gP"otE;JB*91+V6%AC;WP4oi&09U.=c3E,U=3,f@U[?>O0*_V'Dc.O^UK/_KCt< RH:+oT9\n,A+4^rDCl%IC8acA,No4sNKPd?(^P"JLq$H<&!.&([8?R68OB4hQ8C]W :8BJjkoL%'OD_KQ>#RCqXu&6gc;P,HrFP56F#kfU:h[B9WJ7r9c99b4iZS'Gi^'fp L(PuXMdUb$#qTreK3ZSRK&N'/M+.A*KD?/bMsgu_=Utql'gHrP94Y9Y#_OGsLIB&^ K6>3CL^a!baC#%P%l;inOhoIs_1]8o`p,]dWS0l[CpD&h^VSHlQedg6jjFkBdM)O[ 6FT3ggLE:.;fO#^<'U5k2Nr@@[user]igHY[/user];>m$nAK&%m^rteq\2V3#018<b?8s+AlIVB7R E!ED"%4J&2O",Qmmhbr20B(@W@GqV-iM_Ockl/NgM"$D/;,QN:#6rJF^EU]5Lo-6` GEu@!]"0Hf<m.tl>):[3MlDL]kNa]P/]B`\VC(GW1bVqgZPB`L3'L?),Mf<Q%^bgn !Ndh+T=i6m/627%T$0<H-_>IPC0]:ddjGfa/p-XOEGS:e%5M``RE^VsJ[*k9`E=Es =jm!.XT^2"CNf%@[user]Z-7[/user]=i<IlsqfW1&d\2k*W^m_4WEAX8CI@&knYS9mGM'gAB.,"Zl ],GiX[Dg2#f@=J1Q!0_]aeEIA8HpIO9r>7k/b+F?F_M]^R>&Lr$Lape1m;YjSpcW> 7NJXed^XVp,F7=p5MH,i]D^'=]iBsU9sFQ^HPC@A:Sr'MHoZ7CeEYDbrfo]1m->UD C,4V)7&lE8Ghc9bj&PAb;!NTmmkYfN9$r)QWSsRL2>AR/Y$k&/%21*''<E/H*$W4+ k#G99VhV#bk`t.Ml&h^'X[J'$?/L/HT43R@Bmu$_,&P0f8do[rV#(h:h?o5G-$I>d \_A\c0bopDA2j1(4O,1`-)0`]]X"Tl6^=V[7!@[user]NWG0[/user]#:2;*,E@joVrMdSVgbBIeeg %8#e#1ihhLN>VA/W6'3f."4!aFGX*`C?@[user]Q[/user]#nMd^JL\r%;cMi$^N>t["?r]G?QT"Pm L2R&f\eK3YoH`=dG/+h2rT&M$Si\sRN;"!0-5.jMR?2mYcFEkkRjV,o#prWE2"/Et E"X-mH)B[jD5"%-lSrTU'VMjM@pX.YR9si'e\Ui88iY\1BnQdLg\7&U>=r*>LC6l= ^1T-tK-$mLpdRn"K4"T!Qe^$I7<)]A(ZCZd"A<DI>#"%XC^FE#6!Z[M<KG>u_^5/_ >%M[kc,2<TfiIL23S`n(YRL%;EacO[]Dc(,$+/tQ58%0pos?bGE9nTY!O5e#ePZYl +T*+.7/0/I+_:VE18>JAf`_=7[g;jeOmY-U`r$BD)hW?*)g[RO/ID#.gT?s`fmMUG h:q-DS,2<'`l:ELk[&IGn9iQKo%P.;3'9*>C&f<)NPr>0-t5D<E#M!3d.*[S\XRW< FV`X(:_eG36.<&j[^Ztr`s^%R8FWndRT8sG[*;e>85UuB0Dj,PB<r,0k$Xf$r5\H/ (;Dh7:+C_#/&&hB`jsYY/&]!?W1gm/NE,bbYIIr6YqMCq,;iop3qAQ2"m?t7)Wu[Q i[VrsoRReG?:BF2<Edc<oC4qpPs+c'/7oNg`m7jpMHJ]KB4BgBm\"L$^\[[%R!0@$ orbiLYP6ML@B98;U6jqoM:k-YE!!?B+N]pF>28;;:UTt[@[user][p[/user]!LnTaDhJ3Y[M6f[8V #Y!5MN3hqJOF@^)1fWY$oP7?E-q&o)0ZZ/:6F.9Hjk5<29\2I_n#qiBJ&&[UOFpYu K6m,/RB7!Z!uc9]['dQ[]Xjoh6kU3#8`AFf)u>K&:DPUCM-I9sGMS6_?+llHK3i`) Up1FOZY%p5;MC/Obs;q!!`O:cZe3+$4k*Qqb0,^Mk'RXj:uWT%Q"$%cOr#_T,ND$: _n,N(:1\^6;nf#-B^E')nN@"O4t=_#h8FF7*"+Z/YR*up$9#N<dAM4?4o-hGb<;f' oF0d9FcW?I=e4eNX<qf4Q<AjoZ'Xk'f%V[T,-EIF!X[eb""Y]_\E-%N:9K]%3OocC ""!\L&hmXL$&_fMCDH-/XCBq`1Yl3AXab3DBi"(e]DYJ+Lp["sk02n5TC7&shtJb9 GY\,8C`cbcZhV+cSujh9h?_N8DV'P]:d[i@8I9[FA9u;aU8,?kIs^DYrMc9qJ`&JM S&i2F48Bc1_-+!`:`MU[h8JTGp='d"34Lhb(>OXs;-2_[($%(<f;GlR1i+DF!sj?& ]l$7<VK.5m86'D6h.Xj8.:>5pOX52t*s"pF"tGmPStUY*j\$D)RF?7idQ4o1kYRb! #GJ4'I&A#/)RW".XE<7K/QZ/'D<XO'&4VC>T;].=#L2WQ1n@VnU`?Y"G7',VS'WR^ <2iPs#9$U;YG/b%"UYtM;.>46K6ilNmW"2TJ.O]+N0.aG-[4r<_TY/&=YtVHEg!rO ;b7IE[UesBgr&(5WPeJm-RNG>pXat1^K&'o54*O1?>dVddD)]-LhSq-^g=buVH&5& 7H?3@PmMN_)ps0BVSIr3Np>%TI67,"=f3fchmGPKrcq\s&X9M'8@A>Eem(I'/Esl? T?k+$B&Ij]fFGN+arE.-<aY):+jN*#O)"Tj!p-0iF@.#$"sd%i9nH`3[(38hWD8W= P$N9_g,j'5EmmC!Y;N2akq$"jem^XV^4;_>k#I%WO4@tc;NIdqq'ajF+'=TjDU7DX r`@>RlTm3)j7q.CPhOh7Q0sWSQrI*\(C:IX(!D1G#=41YBeKG#6!X"t#5\UP^*iNL s*U3._<.(Jce)ntd1:%='4c.,biC\Z-+S.)B\#jphbE:bOh+(!$T5%Cr&]-e_PT48 ;ON1FbBad,?%fWLJc^"ApBH(JDs5nrmW9Coe(j1/OBiHi:ho:ME@0U=Lu?RrjMc5* GA!Xt594=:';$W3ER]`p6J*C\cgR%S"]Og3LbMK/dDRQiW/us*+<3cg9k2Pu<5:,H `AWl/M/["ZaHSHBMe(A_4LO(,d-sh-8?PlLZr%!!s"/na@\qFSfN)L[_%scR1J8:! CVq0g$Sj`t8hnh(#pV9l'p;`=S2?g3m(R$X\Uteh5Q(r5PLWV$#M@]/Q5.uA$BVO# =a1!&i+jKF65$5kIH`6HQlQD$^BImYXXJ&GhA.Fhb"S3$er(2f\E:a:Xe=pEqY"W< L?rJP8O'f3\ThYt.aHgR>]RKfn77H$ka^2Oh.>n=%!k'O?sfjm='[;'^PGnC9_tE> (Q=,>c[RZ6JSfB">Pm'h\tCm%>NXCh>J/r4=.p6c8boZ8\]B+IfP^.'73i(M5j2%s ,i/$b/!hV.?e@]Rdl"u,&F>rd\^=N[+-(DM[A4CP;+fb);G[qbp2ku,HDdAWjS.2. jJ::sj:(k0d2P.`/b/^0U>>j7K0:PSmn-aY<.+:P,L-KiKc/Z7W2:`iT$b^eoHL:s U``s+npk%9r%C7oTZ,Hn_;uM",?e"1.Z_4K?a]];7E_B.EQ%<lH6"NUQk(lOV63)< Js,o-!5'PGAO>MP9?02.I,erSdM((VW:ul#>Tp]10rf6WimK/s;_@m!lJei7?aE8& Cn4nCh&[+278[+[.8NC/KK14@qt[#HERL:gW%ngp2O#Ij!8_l)r>9HL,Ld6HgllI1 eH=b.;3&Vt&R3KAl5I_DO%W)n*ucC[(dBH%D*-AmMZfPW?,cMIN(;P"8mT!9#pBTe SlSX$OUIH//fscZq3R+gpOU`B:\WL3[16IDk-CKA3#1cnm#MD+cF5g`&QnK-80c"( 0seaAWg0lElQWkuO+'DfI[VBPkN(`M<1L5I^kR"?G@mA5#1Jd&44Al#?=VL?gU"`T p^NqhRV)pR!?Qbcr81\VN!6H]A-&/o>u^lo;,\;<Bh>'?!`:NQ?b:j566kP%'A2Ym 9bH$r^7AdI7q.#oD-CenZ_9g,G:\>M7"Dn\Du#gLYVb8MT5h[%gUh^-e:`pr-"h#P ;1;iXZ9R:BqC8oaHi$GeY6(ZU]VHmar,(B_qhWEc(Y*U/2:InaOE-3$0<;.TWJ\(n 27bitC<FimcW-F!DJ"m8@[K<gA%#nNBFm/-!+5XC/]9+Bn=<d6DlM35B$*0="Q'^< &/BO:MhAdF7p>*XU^<,PN\n0+>\i`3q8P5[-.Wq[!FLm4C5ORYpPnA*XTe4]"RuBO !don,HjB9r+#s0$!T2Bg8JV%Q`g2cC@=FD&*,ti9$MGP7UIWtFA%IP/N`rU%$]`AC !-:.p[1+MKCH1["HUMDr6tL[k5TUZ[:0Q`Xb*mKSJeR!*HMB6EH0tIfo`7S)<]KBm bAY^[=/6keqqP%oLWJ,;=nj\Lc8Qp55CRX8U709Sq!BI=*s(2W'&Ce7h2R$S/r%YD D:M$uo6e#!!RTY84$bGh6$F:$fWYsVbR20l*!]2G'+s'f$"t"bqCp-WF!rIuAgM?u .[BQ82Til;k>T5H5CBsrGL':;4BH6N;]7,G<Lhd!+=a`Ok"ZILDH;#)leo'.4-Dg* S,b$5/BcjAPt#)F]BYY2^#'8WTs<DN'%VWOA&Y(r)&p7\qnp")f`aC*Z_tP^G.2\N #"hZuMqLkis0At49X?14.LC]D(#qNOU_lZaRB^IABc1jBkWaNPjfKM.Q*-WYN*aOR Y61%'(.Ntm+CK:U(k")$3ZD\Ng#;l!&hs1Wji,V5^'e9f4o+rt7lT@8&9$%gd3%6G )j$H7N7%iC39W%,^'_@r(W*p7aiQ)CJ%nY(->0#3Ccgc&T%O#[XV7dQi40BL[^>K9 fIA+<X?Ef$16!%K1jD3D.=qoTH)VAQF%V?T-L]+6;c)=Q:^mq[?!lL-kh+`PXJ??f W533n5_TR[f`CGZH6G\f3-B8]i!^3#e6'+5R?66.>Q5kE[,G,o5$DmjoZ6E*IZ^fs =P>'EZ^A&Y2l,k/J#XV>,-d;Db/\Po8m)CZN#(<BqfMH7\5^Itq(DE7VU@8Zcg4?V fQ$7OVe64<`K%N]T]:4-<OV4ifXe-MG,5Hf>f'2Y#oEs/`[*VjOR"&+!ebM)#U+j4 $("qkLpdQjcE8\C>/@dm>?uA`S^lE]9P6QEn42C),XA:\s"X>%3UcRPn+6Ik>ouO+ n,2N6D!JhHCha87oeAA46!9+?h,f;)c!T0k`5V_I`=aHcW]^jhpR`W2rUN-5_PMK\ qL`AK_8Z2%_:3Yk/:=ZBRlW?dCCeKlgSDGH9"AM<6,pH?6%Pf:K5AoF'\4V/U:\jo YuWnAdU_Uo'^`!&R:FI;RM3V*g$pioJTZ#h6N>j@RXq0e'N]aX'`Y&@[user]Gnl[/user]4@(J>2! jp,1Z`[h?IJActYkV[<Fo!/YRbTRV2Y]XY5\d*)d3As&iQr$o8gXG`l<HJjbr>V<Q eGhPUjs'3HR@`l=J[*pV]('VFO,OW^JMt9A&FrF#Gc,efJrIPD$+<R_7CHA?ZEEct e+H^XWG.Wfq5WkmB;orGoW=UUj<USZ<i2(ZiH:r_87RCtR`)oFl;+cof3bPU:fH!s E<He`?@[user]DnD[/user];ADVRU'C<)?@[user]OGV3[-^V56o]I1[/user]&_1oSFKZoW0c^UVSNX^?jA`#?;pF6 Jr&OG?olrRrtMO#`!RO'UY&*#3(M<2I3o9KJOK/mg=82#^L^5#[VbQ+$+jrAf%K]U 1`c)6GhLlYrFOh`S&SB8[.VL'&eE_"I?mT>>nIMCkqgmtRHXHP_FUBq\k"g'1d#7* AT8`[nd-b>I@FNU?o;2n!WB[R+K)SG\4@uu8lOrMP#tOS"H$L75-^."_fGb^87<*o _D4L!84a14KbA/ROMV1-gX)j.:=`$iUsP,n+VdPaD/=?2mfZPX6FCAXSKqZgmf.f; p0NleheE,Z'KUp(IZ499.Yh+B>]TZjB5tTq^lgA-2;.jnOpe^Lc->81\V3BP]@[user]pP[/user]. YrNNsi]aeBfo__%%<;k(ge.A]'7K$gj=m*a@[?7H0Uu#oQL#VEV2$"dLXW#o0PItT cH*=4Ts$.2Be7G1N2,CMP*NE/qVj]s_EnD2K\-F;^^B"O'&s&:DE^;>i%t8;6\#QH W6RLD^kMPE6Rgq[$.d[(;S%Y'KkZJRrJ$5\$V"E7F(@[user]f45S[/user]+`RU.W3);ZIW62.lq+ VuSHWWS/RoL5F;A=P(t)@[user]a[/user](8oJ>VcgeIk_6Dl+eH]m!65"_=&e#LG-<5t<a(3ET4B 5mj%f8/^!c1F+pq(JI,$VH9iqR*X+<TAf<FdQUg/``$T[Fj'[#hDC.j.m7+.4]+%t 1rGnmU8N2@$LM8\aY4Lke"YOc%9;F-U>sp[(CZJ'S6do7\_NhX$c5st;C^?]!Yu4& MgSWVaU7nk6JDhH'P6n!1=57NcX]G?9Il(oDt,4'03L:a&&)RcW(?B?>54*9,'_4) R[M/M+,O@1k6!Bj^;^1o6CL9VA<XmsPRCg'bAg0Yif.7@&lV-#0Ih=$X+a\Mb%g,j m%+Y#k1I+rH\'&(#)VQOirUalo()[rIGuT`65*TIr1.FsG-H&/XNQ3H;qKL$0[Vh; K[G;[crV'c`ga28!KlRrXS7c1N_0e<nRg>Lj"CuYqPi7H[8&#^m')SsXjNCaX9#od ZH5<7ICY':oFmlJnk=m2j0T[JrRZS&oV$Alp_$m*X!,'TJZarZ1hC.?D!G#&$_&B[ 5ZdPB="^W'^&;u%Y22Js`9oQnP9@=A8T.G1SM0(?.A7hlmG3k.e4OW+onaD&&("<' 5F5a8(;#.#qEQb_.-:QLcEhRXZ/U>Q3VI#\lsHtr0oQQ>X+t[_qL0QpDW2Ae/72+' 24[oK3jf/5BNA'44MY+?Top(eP.k&WX;rDNM;B!*X91:l(#qo8Jh+B/=gQ+Nqj)DX #X>UQTcsWkAkorRhWmU\[Gg6:o6\Ft8X%/"!GNkSM#5ZFCEd$(,!9/LiI,[_nG[0. GjEb.=3D-nhZ(o,\ebqtP1(Z8n;d8SfL8)H\q.;`Gab-*)jAa@Oj<0+5YaL@L<8\T F/_SJ0A"B_<-OJL<_'\njBsiE[]nDAgj.>1n0!(HM<s&O6s"p];gO.6++/GR,f?9u auj43&/bZh#Ua`&,Esep;TP:&AK*mEjVfsnIIX.kcl\Aj'B-+F5Zd9ugPe8;hZCqG k_jN[>G/$T]\h_OIaZRR?/98gC8R7b@Y93A9VQFan6<rcBuQbKp*Dc:U\GcAfF;>K $g2M;E,I+kcf/T.4529-_Rmu[RMm0A;qf-'W9hZ#QXkInmmt!OEsW&c6PrW>k$2^k 8"K6mH9fQ-6%t7U]?U,2ls1bL%V@@[user]f7SqDJ[/user]+;F2u.GHd`g*H9=V&_BdR>*7dA;DSl A;=igdk"=Z3qP8qa1:OA-M7,kjg`WdX(/Bdd-$IAI9pa7K0K$uq[@?_F/i8mqj`N? *4eXM@e=o(X^0<:1F=2ccgXgHEVS/+PM*eUY,]7[%[?oJ'_P69cc)(+@$Tr\AEBMJ q1=d3:puF><rQf>3^:)Li.RJ:.Emb]7??(%d+ZI\'W6FeeX:gN%!7R/!b$=Z*$R]e Li?]_"<re,oI(<tbb6*fh#Uc'.t_<"QX`]3AdK2Y%K]pq5T2TO:;nAb5d8?9m?.f< _831,SS/=8[B3(V!4"?Yc$MfDp&ki1l2'J#62#*,*<D6B;\\hV"oLc+8jT=-IlnHu Cn%h*l6uD.JF"k5pUeaSZTrQp<s5AI;?e7HYo6u)9H#\g,RXo;XM&Hg[npa>(aMPi >#NT(Gt.p\:6TK_'FZCeYMOdJ)-#uRs.=U>HcL`5ieKI:&<>7&"_WuWP&r:"N:htT a]To3jV0erHk#b.ej_0R1=jtn,BtHd@qS8oNd\_*Paor2\OJ_\6Ot!q:q3X:WJ0Xf E)lYXP<CsfUeC],M5%SoR&LWIbH&f,'g4=a]"b8jhBQl<g(`-'dEA<6hM4h=NQq:4 GqOg2G"j>A,jeVd`sXEInfkV@-'st/,_L]7gA]5U]2S&/G8/P.1]>@#KG0TM#3HN^ 7.`TN8aM8UU1uA=#]^7["FQQS.0Yg4^`_YdFg5rLA<T$;_@+J,R9,d'dJH^po\36M o.c:!CeOu8MY:*;k++q7"HF$;?rD+]77B,&gItA[a4e.k.i.E.YdFV+LHSn/i$7QF bV6l+Pj>2K%IjD&?LD/phKKs3FI4'(gsI\pQL"aeERT1nXk#;?c9$gq<:7gRZ!="g ,S16C5U:pAH(Ne-DC1GV5cu73j.b0-E`9$IorM>4gY&]umBlTZLM^DEGrRn_HliJg Zs.bJ+$AH4o=fV/]pcRq+oGDb%<Eq;";S$L2=2Z'Iu6s=eF,'>EFUM0,!'s"eCEs! 9!P941llmGlU0JK*ejO)gN-(u$XZkMG)R@\UdoW0h-X>6VbXP^<NOO=2iVIo[p%/@ $:;h*%Ro8oBWp7addXBE]lHj%=Y"gc,"dN;A>-CC"O/5<bT.!-/QV$_GP%]@[user]lqZp[/user]/ 1N!9^8/.!,m&D,S<bpPmPY%SPD[E/%Nsa2LI@BQMGfm%$3`L!.Ml`Us,ZPsLi(e7= ^UgbP"e)E26!jG6;e`TID_!S)KjJe"<ct.sC\8\o)R[(*h2p7U'k>CfHm5&>U<u.7 OaU1NV%5;!,3a6#AM^_7YXE8;)>*dqYU30%]D>+!8b7IA2rE/6cMN:FObZa*<3+Q' TlcI"jo)#2"a,FNiH&@[user]Uf2[/user],uVW"!UkC(o:L$)j)p3c]@[user]H[/user]?pU`c_VK#tIU+At>DTbb i?Z[q8=6[!!6K]tKR*\FgrP:^=AqkOQBYs9$PLpLAL<ue<IUUFOmRh$Wjg3IlBBm/ l_W%2IEl(J^$/uk)ZXT/K6\W$$faqdC;"+e+ICtqFdH25G\8%8\l[R!4A3+sfq[Y, =ZUaONo`;c.PuCBl+sXkXIV%fPdB=@[user]C[/user]$-%1ha+-m@qWkrB?Ar$,u\MpQm8Ajaaq[u ))A',1.gis[ud#a0%)s9(s$CG9kLcTNKVX!!6pQL8:'ARBM*L@VDQpEk%Q-s=?D:- ;'lbh`2CV5ij(3dDp.If2F,`dmSXM8m)=+1!qAI0`(Fs_(l5TZ3/B'm0/"E,G:WpH Mb?cj2jE:INiP%i-39,sj&+P:e7.drRi_C$dg8&Zf/JbT^rIi/Yp=QRcXq(1e*Hb1 j8b-n(':A"Zb"W8<]3cp;Qe90"oF[cG,(S.:faAh0YPb0.6RQHmim*]SXtm1:k1-B I(<u=b\ePOi:/=b[,GSlg!*rURQ&oqTcWteIgi-VZ.c%O*",!5dc-]LersD#g%)u- !\bsHd-"(#-hBp-T];R8M=dP&JYbHON1D(X?5#s2)Qic^BTTE_i.Aq@-)s'-/SM(u (h6a)ki^bg#oL%5!I\:R'd"3%8E*E7A6r6k/7h)up69d#qdf@g:2/RArJa]*]mk!j "$jVY(3/R(KSA:CN@#E*`*5p)"&gb%UdY,3X]u0:lu^KtX`#pT"C'(U>:eZ04+E0r )XXcJXDQLY`C!OS>*G@MDgSe/:^m3P93n#^YFeq\g,k6ObugI]]CsM4>oSc\+N]YH ('WiQ3'3T\B[o,-oDl8/A:\U&2P87!"klWc-"SCaN$tk[Ct&i0)gig%*KVkRk$3rb s38jaaKU<c`8(?:GiUpcmRhuD"9*kPDD4H<27o":FGPoWDX/*RHP,.U>,*O@d$A/; (L0A%``XXc:"04kfWWUU\HPZc1Obn@"B7eVRUsp)[Lb5dQG`6N=sFCN^E?+j3!MoC PrBD#MQs5)"*V'eeO^-(pGp'm)_V?$ZBm_'FFl:o*&nQW&0=I^&<)U>*uO(f0Xs(d .Z5c#UWQ68BWqEkmVuGQpsJ+F-[ET43j-(k2d#gRb,$..QAJN3)$YDTILU!7bSiXd Y#MAM8kHs"d][W!Db8TiIFHr#jJ*e@^M5"FAs;M^gtrtX-6jV7plL]8&a2!0\V<4p 8o'0^UOH#s<ou-n,TdSTPV=]dYr>kcS^%E$[\q?SF/N@4gqtqn2:"9A&Og\k;J<8` 5fK>D3qj<NIXtPtI=ZI54TqoK-`#0hkLRj<pOZ;,I97o?9fs.>*`B\P`6?K6h%bli Mk*bFBO>8`Q/:?+[3"ah_ar+I1*cG=HF>hUMiRMoOc,4k2RikN!FgE]<ko`3`%63H 'rcrZ5pK+!K;O+PjDeFuVC5Nb6]+$`*c%h2Hp;@[user]9^Jp[/user]<sp@LqPKGn*b[\4h>UnY15 `7'`EOVdRS/+?1]k1#Tic;VI)PO+_GHanH#N2["gq=sS&.fo;K@t\jdd90BoT,65' <l.bf;smNUkM(m[F/<%:)^UdAhKRQ1Yj[*jEiUSu_EJ6O0G]!(*iiLR&^Ka,HW@C8 W0ZFkiq9)Qj\UWd1IX9;l@aE]27e>l-SjBeApR`Qo*G;q5&V3i0umA7ASQf^/0F^Y <9UF6Ju?I*T)'t7.JW9@a[lT'-<mKg\"_,NOt"+]NdkR>Yh6-%gl5q,l\6Wu[eP<K ah]OtO`X3To2l:;2i_$_JWp(`%N0%dJ].m7NgCG0E<K3fn_(fVI._"X@BSmLip/,! aW6O2nQs6b/%q2s^;oE`3/:ha\u*5WW&-_;<^AAgX'IA/Ws.lN2;=][#5e#Zq9=D, cQ:mG54W=]O[mn<?U4l:4;m:7UbX[-+k]gN>&!a^n,=Q<\_7k?&ZJKXQm8@7?oa$' Jt35P[ipn-3kf%2i-sO9;K9Mn,&*W,#MXn4WlcuCUGo`WIKjI5"#SlU9ZUWRf:\9@ *ta;SEDUUAWXh_f6!S"M\5)]>7$Ak15SVWPBt`[u"\5aa?ZG;%YV,7^%2Ru^>O2/E i.,\JI_]ui+2P2/(8PFu%52;AK%VD8*6huWNT?U0ct#H<TXN-8$h?H9&g*e.BF0L^ Vj^P*ChCTiZ&RGdH=k-N0659K<2%=:/P=5ZL=j5[`4!4V)`LpY)4:Sq/-In7ck(8K H<5+C4*i>$lu7(1JZ7;fmn\nti1iN3dHC@_TQFdP#tmgHPm.)hb5N*hT"E_Vd$at7 /-#D!B:&Wr_q3I:c?=*oS3!7TaRS(H$0J7&n\*`_,D8a&:WK2CW2\;pf$Aj7QiHr0 PI$HoL6^@[user]_C_UQ6WMr[/user](_"fX=7`0k,3"4-"rHGKYcrI#H;JFi,'UGqFE5L$^s^\[!# S;!'.ldCA-;`)!3I(N57\+&[Z$XO92n`86MgoG5Q?<s:[R;jc@$"h25npSKlM(eUr VU@8ZNu]HXG.VppdkauZ)li<Wm,FkMDRWe&41,j:<"ZZoKSq@B$P4HC`[)u[$+ZYg ,_3El+:/0A!au8o;Ge,oWE!`ilINCe[bJcEauJ3sHTB`rFS^CdnQKR<[POKPTC]bB q``@'HX"b@G8XAN\o;8oLo%"VOp7Pl0Fb[S_3_HLb)>9D]pGsF,5QCD5W/'bSh1M@ p\u?+j@dtZW>A5?rl&p\:/MV7(*HrKs!0,)r.5:>SSLjT$bTCQVdASX.mHB;a[.$r $ff.TN$3n-j(B,(aNuf>LUaGR;Bpg]9Zfqsrsh2EVU3LadlGtUGkI1oc\(gg-C+H_ `TEQ])oVq(+_1dBTdkb.gL-_i2$c4Z'/PY(5Pg9Q]J'o;L_3<+W93XD*BRNM3@-Y3 bb5F&:1pf.V^B8uWXWq<la*MSg,@[user]8f9S[/user]*M0CJ\K<r.e0`DB1F?M;#rlMWlU(DNj94 rT^cF<>M.Ur>)<V1e/Sb%X1jT*got8V4tp(2lP2=Eq9(Nm,NH9Yt1eio5iEBW8r<T *j1>/!D[*i)1eNl>dJ8ihr!!>"Xg;,#b^uGkm8X>S.eB]>U=VI?cWfn#tgtU!O59> ;-I4q=@[user]D[/user]#4DcchhI#L3l)VKQ#n5#1W9j-[4q=`hOX+o!W)$WYhqn/@W18oe>Y'bI9 &s>"'SN4H4OcX/g#*oPZ&'h,Ua5"?r87,#gC"'MpW%;UCX#HEqk.+/T%1&"MU:[3_ A.XR(n=t&.`c/&4e'9FWZ[e+F&=;Au`MBfP`;,C7-^pL0n_b!nH55;ml1u?`jL_$^ 5N\@(THmFA"@[user]uFmP[/user]&%LX%^lOL<40Yp,e&4u\fZ'6(on?MncUt#DTT/4n`^CA/hW!\ 7iLFA283<:`Ymn4D823U#'B@dBk[H8FTlL'H%qHtcF%"RqCj(K_jJShPJ6;D5$OZ< U^f,).#[ILP?OP#Uj$"d@ZXO=@,+aoOZ7Krb3OlHe6pok"EMY$"?G$#lEs&;,FG^\ +K;9*YHedh[^nk#V(Z7gdY-_1k*C\S((EN$2TbI-?qLT-QY\pkq&ON[oZcIHX;lM3 ,p)JrrI'XY8ZfNnD(P`+<5iPgNWkg0,n1X0in!S>2ul8SL6P]T.\<lC]L40(-mCMY 6W@W:L@C#3s(EVui:7Vn,JrrAM2WTgDS6m/BKJK1>+u%>a?U1iL2.c6fHG$X/>go[ 3-#XqK+>#2=@[user]oV\kmN0[/user]./nRpI/++q73k7Q#!pjsS/7;MGPU_29\9GlUUnC-<OORTc @[user]^W[/user]#2V/+k@N:c+[>UZ5PV25q)%\MrbNQI)8L,&q'[E:p[!=G:Q18b/\Dog(em&e(? ED,Ylf$5i=^Dcef=opZc)n/4S'&GILp=jf5p`XSg_!`\[A-lR1egkn/US.WQ/0]ue 2QH_$!bM'Z5I0HmegN;_Yn1(_NpF8<,JXq9(dg0@4D5%:kSH]I0s(rEa=3B"D@+jB P^4p4^0i;Pf,/R"#C6Y/(.n0>:4bo1&e(;WP`(r-9uhB#a[B\qH>lBZPGN)["Fo)A 1q+DK3b/4h.E.-E!His(>Y=3X2$mP>M5.6P\fL<r%-m8V0r5!h-I/Mec0-+gla*mn :C-KmR:ii,(h)/A'Oo5S3#gYHVkU8O.l\jY6M/BjO0V(&=(mX&OZUdFUe`!K!CNN) -6(7C//tB4d&ZMk]D#jBdkW7*Dr/,\E<Rtj[0PP`=nhO_6@,QcRcnUh[Q>/75Lm0k YoIM<[ba\pWhWo+e]fD6a_u%;c?ZkCcW7O-k5Sa.?^Skeig#8[&\6?jWsco$%'/D; fu&F2hFUi*k3kN?h:u(<<o#<34'8coXrRUL44MA(T]MRMqO>WlC3\kZ*o$gHEe?*J F;06iBsVtf27e<6^o[0<1>ih/meS0MTWTRL.@[user]gY4C[/user]$N3?F:oDK\r'o'\?6b4haB,F 4SFi-qhX$,WjO,'la7L>PG(8QIcVHA_\MN/8VHPN5_NrQ*j%E(khmLA`\":5-rJ%_ hG:"]W-&oU?&5SUdUYo`X-B(?"%?TlS-O>d12)P#41ag>etdK03NshM7&/UNCc%=k (XYeWX<Df7H-XcQm)LE"\Y+7u<E:Ed-hSpY)C-SN3nn2IdK%n%$LL%*,W[1;cbD%m `VI?Dh-=:;dFu=-0BDH`m5]m%r7<:\:FPoeN1J7ihd/Us!ljj/)FV]!SZWjD0M9h; 8taI1qTf0tf'$sRm<4I$&L0%qc:1a`D#27^nNg$#:P\i=o-!riImR]jmhid@=^'VJ XW:&mqt:H_GrkYQg&-66q]AcG#uBc:\C20lFOg)jRqqtmK%fS7okiIOAkX?!WED(8 :hC<nUnkB&0['ps#"Gs5l7V'`iZ<[6+4,Yb@+Cq48)W5(G.X/gQU-k_@NE9I!-e<A V\Q@TYhK2gT5F";`5$9ZdpH(@[user]8I5tarsd[/user],1Y1pHM02%U3XmHQYr]*;^U6#W0<oeW( XkH5,%M\bfnHe_Q::gBCdbP"?))o'"6WeK185NVj+XjPXQ,g[V7raI!6NuJNaKFjO /[!D?.I5hRH$C0o)nV!-DT+]!,$se!bb0ak\eo$*92iP=Ap2np-_pANmqRpL9O*"9 &toIoPVS^2Lf+fH#GQcH.#R,`H.Je8he.VX"/2AO09&R'gW7He:iJ'r!,F'1"9fBA (dc&,K*4NW.hE%k=]>UI#_oJ<5Z54,MN!*,QTk.)R^-?hc67J%=;q]1W+Ek3T<E`6 D1>k6rF:7<9DU';q'&,XdIP_kZD_S)lI&0W_?5uR>%DOWjV?D/N)YJf]*,fsp(E67 kk!@[user]4[/user]/%ptJ9>9Gk7$'lg6u^a@.1mm-*k'IY!0jGD$&Nb"8e_:=q11r&7>\NoM5#MK DV)bSB:4mEQOSc17RBpg5Mj?$G2%G3RsT!,_Zt]?]T`m=`Nk/;HE5!n0:tj%']:ST Vi6PIc8\Z0/6k@J7_alCF2_s(bpXn=QVTcXC_[7O+$^OuoDq?gZkP=RKgYskc6O:p Ma[(Wf#p7WWV_Y7FZ+Pi3d:;<mPu"@[user]nB[/user]<p.E6?bWWU"qGX2oZS/?]@(<07<H!(h&6 #pGD>HS7r5&g3hQ#nTXPnYH;E'=<QrcXpI,eCO;_C$2QmlWKe5O.Pj]T&73aGq#n/ BE.N-nGD#0o6igKYQNARq<2/U[@!TRN=U`J%n36Rcd6FdFn>ImY`Bjqc3AX1<0DS^ :El)$Mn?>UN3p2shl5kqmk!p$hcH%i6JT0JGIpT_UBB+%lr4rol+Ck4*)HD<5'qcD 46an\]P0E@d8\Og*,.Tqb]js`U*#Q7!Dnn(!U?9NKMrIC<fpKR1/11mfbO`l&LFBs 3<s!Yn()gdClRhd1Yc'f;;G5mQJ,PTajgN(6S>ZR<:k#tGSY&Is2,+Xk"YN2cX/NG Q5Lp;8#BKNC:8tH)CJ"Acf\=6m-^Q!Yph,Amg^[N]0:Ig(j:,a:Nrmr>^#4K3;O5E 3R$s[g9B/C=koHb=)"'7G'B`?(`#"F1&@[user]GZ`fa[/user])p9f&"5':c*:E->%E\'aZX#`a$3 *80pS<H<%*pR<js-GD\o7O4r`@[user]Tc[/user].<]<$I2E6bElS\pGbXN.D*lm:CH(+j)n+$%el g[$d+W-.)ngAtMh`TrJpe>Y)[&/GprZBtjeY4$-UlR?kb4#P9Z4gLgd4i11_c@LCp i.A^]34EMqP3m$rgQX%7\!qWrMo*kHs'rZnY%/Qk9#Qlc@\Q;TfWIUqrtG>Df[<^O *XB-[Np?_F=L'%DjomSmU)H[kT#'6]mb-bW@^\l,P.#S[mlgnk572PnEX@]j2P0;9 *5'&!BO"2BN,/-:0?3lkX,<7cfl.\(<A^]^c=Lh.2;hKgjd\/$ng[MXX6S>Gr25Ts ?KDH!5]c<DH6<3mik3.r]aA*9JYCUZ*%R_e=II/EOR&Z",ppfE%iRKtl^rT]8@8.j oMuGP[hN;/PQ`.kWj;<X#?3k8D<\H6[Z/pem\\_0fSfB$:-l<F2)dmKTHh3GiNa#$ S^Z]J[]'/(<Q33sWPtToP/^cLV$msRkg/bnU5E3[#ust0p\<V9o4>>rFnQlW([f-u EP%1*6T/BP)#%IGJB\FI^a=54Rs=$^W^[%JEOuoJ3TPDW\E]UcY_cU2"#ci=V<#3H 2i1EH>B3I;k.52lcmt1FU/a3i!?O6IpE6P-lXAiaHS:iDn=Y6b-/1jm4$72tij*an 23810!LYoSg/@8dWM55MmNQJrpp-oB5,"'1*7?_j%]2QDXOZC8e6&%\$o`pXQnuRh XM?ZBD:/1]r%g/,b_iRIns-`DPJC7/OE9Pc.OC,>\Z`A7!XbfU`)(U\L=R%="WK;. fkUT4+PI.K7\eB.AE6NeDiZR(+k=!0e9s3-2P?Fa-m=T,@[user]jtdl[/user]"fnq^Xs!(b(V+h, ??d95Ta*b-b_'5F0L&d3PU">mlB.SJ+#5^?f!nn^[\EI@B5pjRRO7-RY&WK7$,Zml E0A_tC=^N?8upB>&QV4s<:l"KQ_Nf+WSdWpg#o0YnQ3IkBi"6e*kMLUXPj="7m,H' [:%cH$geX!eUcj8GU@A0e%?bXbs.GTlu/iI8t6>(A:k*8I#e`&_E[NohDD4c]YGc@ VkrVBT`AVucIlnYL(.Ug'OQ_fa<a^2.=7:`TJO6`J+]RJLj4gS35[4U#`;J]EB#@[user]1[/user] *1dc/Rp@j)\f('5HqVSs2s&^JM+lJiFf;fCZ-KEA.G@1T`g4OO6i%\"J*4f#1Bb:9 PI/deUOkS#,/3#dEWiQO-MK@o[$W9HV@*d6.X7,J<`,!p<!>sBbn#=R&Ib=S;J=/k a!@[user]29Spu[/user](SSmPq#e:Ch_$*8`s<8Kc\fKJ?A9Q8<QLQ?/Y&jo-'gcZ172h[r:]:d,U X7o"=\hD_=?pcB<MohntX7km\DO$K2H#!>,(.Fr$:XH;okY/%I+]OD@.PNX`%$&Z' 3)mC0!16Lc!\2I;c'Cm]PQ>?T\O0T[p1W1]=I%:'PYhe'!o#B+!3c^#O>JF"oP%QE \5"Q)<s(P$nL@Dq3ZZs*fV!UjKmAqn?AR#20H(&2+Y9IT&Agb8+TOT8Id$,'@%FOG 7$cUE([bpDU,S"Z[k8SgO(Ea&M'gb5Nf4tCEqEI[^dK-'SMsDcn1EKb$c#/'(hl:c @"*M]B;-b8QsL=N]CfiSpsIejLVKq*7'*e8->I#mfL-22rSbA@p51D;U5-"1$LNEi j!HhH_!F"@[user]Art2[/user]F@YF:$ej<l>fnEbt7k;qZ?_Z(1XnfKL<7^S4n&4fj&#])dh;&FQ #K-#Zag7h,]PM;b<7[f6C0_UiNcDOCI4B_YQ*Dnu9:'[&g(lmU<JKr!!r-b[QO,Bo )])Nl=^4r@\'%MR[OJJZC02^*.XOt7BNPYS:gm@4#dg%X3aV#JFCY"T3;*B;!.BpG Wdqf"EGiqDFN);E_iU?;Z(#(Xh6_+WQf+_j9*'4b"@[user]g[/user]$PO4!4"MfeglIO:cpA^W01 8oaMjQ.+Q4*o+-3>Mfdd)f6&0E'LjHT]@*UVJ=CNIFq9O(sO=5Mcr+qo[!B]E_aJ> OC?i7$o`D`!QM\lId"=O*4")@[user]VfgF[/user](=UmnMPPM_^msq,+kh6b8(j^,[^/E@/%#-q` 1ApqWd`.sP$I6+)6Ig:*Z>U0Z-CZOW:s0B__Q'!EE2Z=r48Z'tL=<t>EJ=j<*(S(h ^QI^SG?QYY"cf@e#0A_qK6&rQ.u7,lgUleOd>M="Js0l^Z]T7rpCoOL4?#uob]0X_ rOu6:<a9#eRZ&",EB<iX<0*_Cm;dDL:&7V1U[jd+8[@[user]YuAlk[/user](Ar:W,pp]e<(/m5G7 3C1&A?JaeG%O#()UA)p2JYN\2EJ1#(G`GUhPCHE##7/js74rXCe3Jr#:!jFV4c,R2 iL,(Cr.UBa"M/Z,A5V'j<P@#*'BEnLgoAA#Sl2%7>,RjE:`YF&+!<\jeUS4*a<@[user]od[/user] +>!PcN(5j6"%l>`hhb&3i?(\)p;_13?OFZbPSa=+JFGKSb-:Ab0gk^PO+%m17AhD) ?SFf1CJu#XT=*$tEDJ,&SIC.nOlb`K>1L?]C9sQ$9;PEdC%?4GPBXrP8EE.RJe>_1 _0dt[_4Vlc)!u,YL*m^dK5tG=<!rTQ2@O6u1CVh1Fk@+TBep;`]P!\Rk*'R*hbH_d M`Y>1C8qB^quKuA$Z-Ta9$;]d0=Tjdc9$om8VOSr:&:TCYpM4n`XqRJTp')%#Z-^' 6c-f#2A[=c(tlp;,YPF\f#?3O=1cmQ.nd<uQ\8pS'"2Ud/;&cmn:bgs-JV/t)OLr( L-XL-47d`"*r>7r+YKUf%t2u\1cjOoSF\g?k(6QG;OCsN,4XVHLh5%qaWtMFZ$q>* >Ukp'(DhuuIH"'t,DlW2*`#UZ7+n."f!Olpcl]c*m+d##rttqrKm?9iD.QI.Y?Es) ]#bjX-_2uZ)?a`[$QtT!9b?!SVms^c*;-*6;RVmbC^"7"PYILi:@[user]j[/user]?>'hbZ$W[N-R T0d;+bYfr!?lcSCGVu=\ns[^W,V![h34p:";;2A&NuFo-]D]pV;Y>_B?ZBfUYaMjr ."qY4+7B7#SR(a"it?/l*W(6m'&V;kC\>6?6+Oapda&*)rt?&T(kH*tPG?+R6&_I\ WKT$#]"nV)"Lc>gMg.b_L&.Oib(k&8%`Aa(ZSPZ2fd;pfNXmsE*k0a\47%.-;));q 0,`WWl(`iY&nFXl4;8<u*rP0?1e@01Gha%-6]f$s1^((>cEB;Vd2TK&]u$F#WWS]O WnDuWlQ!WVAP9^,mkGkJ'q^H?oCOk;LI)55]"f%Z(GVjK@Q75]ZYCs!Z3IF3L4j;O eZItif'_j)KG<etb)"E6B)g)mNV.sa5M$i&M39cpUdA<d,DEe.nleU)%T"-ZC@dt2 "N0HTY#E\(Hbh2'f4ub&dY?[-:`dF2ZE=m(f9Ku/=j$)a.q+V_iT^^oU_kBI_a^+r \$aC4D\K`Z(lZI_j409_;u%fi=0C3MP[3<'=ubm*S\qTC\C;W1^no&b,sqddDZ$__ qi)%?V%e1c]_XsI5MeBF,K/>n4@b]Q"&:Kr&:0W%_ZkI&^/\0.0:U/m%f+EaaOpRi Lee/Wfl-Ben-UNmF,A_)nn+n;b1VKhloh4CUUlJa5j8%!4-%M0<pFuQ=C\`FOXE0I 'Ah0-`Bp"DbLANrh/8</!d92<J_.`a\)[)^P[/&5=GSP,_n'8bYg(JoGli!$DPsZS !p1cZKV$OpCN>,U%db\q3;fcDY+j_f7Od5fH*C^Zeu&,`jJA?@[user][E\[/user]?PoBS`a4`D%B 5gEUW@;g<5!J:\$nX?$iTPnk,6aXuC#:L'P`[g4ObnZ@rk$.N:1tD'^LBBABSMX@r D,gk_"7Pht<P'6]No*a8EB5*I[taYm'J9npM<O&"fqDNg"ih&!NBSJHcu&YcrYO@' X\7XhLck)J,MN4T@i7'NFa+(PQ#bdP($VK2p43V\.n#uq!i<OE6CLiA?FQoj*ep\k 76pP]nA\h/AmA$LQ8(5(e>+e"4*Db!l(;EAMqLSq2o%o2f)m[7!c>351h)a)%p#`' jEou9)J89hnZ\!f));_)7TCIt:78,.F-iV`c5;$YJ=Hj:?4g430Ug+_U2X7Z["HaW "uZ;/VCL;N6I"XOnLbQHfs#Hl?M:gaK'P?C-8*0t>d>c)ag+@%rk^L)7_:J,mh\&K WM+5]m<&KQLnP^gXO>Pp<'Z&$s.C:1.XS=5e#[;K5ihl&eTO*V=rtcDXXKlM&uFpV W-7^GWQ)_q$tiR]ZokDC_:njF3+Re&Jl1p&or*.0h59]me<QG-Z:9.7r"iY[-(oLf C-ur`>h9b.SMhSM'JQiq5Jmf3]-G(ED#_.&l5W@_%]=B$:OUD8V_]!u6OKAm^oM%i -Yh?R"-_Bdh;Q<ME-F--RGD;Md%W;GaqRp1XOHF9ASF6YdIAA93][D:Lu`[O1SZ2I 4QS\_,&:fJiaLaP&_Fnu[32`hQl>6I1,T3HOeg5f1?r[m>Ms9\7DK)+^S]npKhoHH O0!uOCcrbM>/KieD3X04kt9VjQ<]VQ7/q'a04=4]K19_Vp(8:$hK1bRV=emS$:g([ :^5fq'#%`&&Mh<7C-?PRY>0B,IFNZ#LX7i-_cu^%>0.7kVUcOU]>;Ym+ROA,,_!<8 hp7s.,5.g%<Ps/N6<IYpCkY1I]R$&`l"+@[user]c5u3oQ6[/user];fD!e4S3kM]ZfT,8f.i@i6u> b:.P;]V=uWhU3X:iN5E@C/P>kL[A*;m$Y],]UHQrbm-2[b/7g[S5E"TXV3L5MJ;CM 3Gk=_,:dSGY`MMmXJD,Ee`Ij89LQWRS`_qerr<dj15b^2V4?R[pao6?_<,ADje$R: ie&pL7hYX.M>K4Bpdsf5Aq^.H"PL99Y:[ptDQ^64K3n&q(jPBG5JW.CgKk;CVArZ( 8ZL`%A0@(E.0_Qt1&gk#N;rju>pq;,3a@-4ZLY5q^FlDTTofPdV6<'\2^G+KYlc;0 ]U5XEh8udOaCPoV[Y9<40Sdm#&(;;Q,eCjp:m/j\J<i])D0P&$&1T3J:+tbio:0n` <2"19$W=&5Kj=Jp7#i.N#c];LQ_*$a*V5mJc4WG/G6BZ'Al2npm:HL&1uS\$-b2L` >?XR=M\k\;f%ZrC$7tNE3HkJln)'U8N\gT2@o=0&57Mc?V@kits!cT^.(p]r>?+lQ h(9Xc\7"O;qk.YY9`sP<W_Q9T>Z%o^?e\,d40^]"Hi\3]r'I+j2Bu_co'T&hM54kc A5fh3SK.hIO+*(8Oo1/SEQnrBEcoM\]chW<D[`B7n@K/5]ZsergM(7T:0C%>S&l/Y g+TsD`aKBsKF!,faSYm"5&sNFBhXWI=<S)D4I:^%8^Q][6j=,JWaKgPAg5a]N.A!? (!L/?+VAHE;m#$10\"hTP:14,3<(K'JFrN?qD:QfE(1pLZ+NmsehEAjJmn7JbF#;( dj7r1.ZcU;X2f]-5gIWRK%d"aEHhitI8iWsR8Ah(_beerCuIT]MK/4YRkCPnj::G0 `?'T_?./[odo!E+#\1qiZU,s1:$8P29e_Ii85AK4UXc"!DjbSc[34CU0Yo!6\)VaE [d.3\c*o\g;q<=aane"P@saS0^Ii$b?P-*uJ#r73lg-hr0DhE>mlQP:=/%]tf=Tjf %[%8^f7?ggltkLXoq>RPYTc:#.$#R>KEM?%+ch`*?[fas*XDfRJrgNd&4f'g"P/Qi aFaif[]=Lb[l\6QgM'mT[e<Ago61"['+f7Lo_Le_j88hh5+hT8""W@P3G&:&8WWf` %u<0-fr-fmYgqEK=DkKd]@[user]u[/user]=_LKSbOhg>c[ps5bV$D:'s?MR>E/'(V`+4fR2fK@1e b)5+)*Tg"89@HN=2%u8"P_ZJ':2=LK.]k,Ui=shhCOZjt\d/^H2N^?A=b6h8jgB6& (nAk9%O'$L(LkLIX]di$^1aLP3UJu\/o<kmP8h[p<ejaT?E8[SX>1JdO\'X"Q,>Mp a$>"+*!nS?7[kd8\/h>&T:W%W=IB?a%`]Hd<(cg/M]-$61t?QWVDVHoa6IuP]m-`` OT6G<^Ua2IGTiVd,#F,\_@f]Y`FZ;Ajc-]LaG9;<:,9UCSML.%o(0i(P-]6GL?L`3 U_@*+VsP(eR=l\RBD#FAU9bO[Skk+V#3kJlZ_><]>lrZF8Pc$9gNgXn@TYm._ZDm0 HOC#*HqBV@Ou?OTICNY9?dU9?&M&+p3h`LR3O@QK',SmA=oB$qdIR:U^G1%lW1c.+ ^uutg3Ok*sM\]*UcWb.c?+!u3*r1Sc>Wp@Ge*Fjk<4c#LP#pR.H5W8>;Og:/;,O0# /(KYGA!@[user]u[/user]",2+?ngtE$R9gee\GZP+IQ0iBd^iU?@+m(Rmq\eW]1#"!npVl7A@0M_: p)fkbgVNO'@!^sia(H?+T'27AmBK.'Mpg)OFTEa=j\l'f1u!!PDn)0uT_ud8brCGP *B][ME$./Lp\E=<WKFNNOl.RNCA@Ia]N)/1OM"G&KBY)/eOZEPCMrKE_g3nHDbSBt nUKB*2L_tUP&)K#?*#*g=&L^qjMdl#mb[(d_],Ad6OJil(VCL0pniQNfU=&3hdVfX ig9l$(Jf\JH#Z[9_ubM^YW,QDTUUSu,js.SUH$1!mPZFrF_B8a1G=Bd(WWd"=L#>G l`)jY/G.B[8!T.QZ6R.S'j3u(W/-(pdN\OQiRBapF<DpXdmJMu"qa,YC&32+7=3#4 Hn?#5UA&*&>q)K>nE8:AL6U\]'W[0(lHh+4(VSBQ[#9;joE0i[a"C>T1UZ1<5gl3c 8)SrD$$t<mg7sCo-@[user]u[/user]<iE"st@@M@AbpFCF.L`Rg:4qMi?MUR_^o$@[user]GX[/user]$<]\g;sX8+ ^AC-7b(GJQ:a"ajg2sHO`]8%e%</<V:n7<;T)@/Vh$Iu]"AlnD\9$X4/]$W:T+r_u =9ZZXjr2%?Pfa.%528bcKj3a_8QQ6r=m@'D#D4rmPa5:4&Xe@\hQ'#!gcEar(mh.a oWc4F&FHiS)DtAB.4B^dL""G:)?%48@S/'H_%d`.RA&//VC2`oJNHS#b!bcNnp6/] Wnre4=O1-+RCr$>Z7ZO]>-lmF$0-UA;oS*%8L,0)&HD7;q=r@h1Od5NoIK5`;7bu; mF6s'6d=st8Pm";1kE?2ZsAb;gKnL_2qNL!pj23`=N[I4;3a[CoIlG.Q>*f2YLZR` Jb7t'o;Hrigu1NtFj/KBWT*D,6=FSR=[`E<dmc&Ro]B><Y#F`JfdlsjEf9[^OkZ(H P.R*r"&^ZhQ^Wf5@Z/m%e&?<PSH7P:)S>g+e4iQ+R:q*rhRN%X5<t^2VH6<<VN*@[user]Z[/user] hh)uIN"H2n1Pk0t@S0?c&Xk"NHJ*70Rs#QA&u(d#/Dg6H;<1Cfj4SrOdo(!^ig]ik `Hs?b!fV[1q[+mr-8UTIOsqTo7MJ1Ck3Z)-/WE%(Fn?<!lmn1$OG27Q$P`j@.Y<&U leD[Lfa[cBeAHWj@l*atOdIB-hKM=K<'e6U9KW]gd&^@[user]X[/user]*EIN=iu$eA5MLoIWYd4< H'`@[user]u8Ont[/user]<3mPB:%<^,r_4bAbmrFt@?)3kJ0#JKAb5Jjg0\P(XC9nqARdL1G30At3 9cs**JX@GRjg#mVMq;5:i_P1/+:NW>]E1%\o$FBK_p9j_'j#98Q.O_(Z;*XNX_Dai $;J?>5=3lYK1^RV_;+Z-kss3I6d!0/2\R7fAj<9`e+Ap!c!,YXfA.W4^$!h@2WcSF N+LrQ9K[!Z&mLZgj7Kq0WYl-a*LXa=UJ?_q/%N<m#/`?+h*Nc+Jn0t%4l.mb>4[KK L%Y)FEj'pk:X"Uk^odjPks^=*h/lRint+3&dcPe?DTZ:uK9t/!;ebF'DG*c#G^h,Y qThMrPEFI`a/hgfM-ViY58*l2XD>,ISBbSZ/Z\h+I?Pl'<b93\'Sqt%C_j5T08bLQ MZuK]DuQSZ4rSW`j!F#=1bY=_A)@;[kHpaEfd)3Pf]pBH981cSpX=3LRX19W_n$Ur MW!#F-T_N^W1QKKU3Bh7m)0(aBRuN8[nuT&BIh0e[fZ(o"J]=-QSEut#&!e>W]X6! s2AGs\n9:&dR8Y\Zd&$u/D(H`h#dI0M#DQ)`=u87&]L"Jc,S5c/WK2gi(P'pg!dFW 9Y9ZSi#;l"!fjLHRs['!0^hug).&lj<E3s]=*S94Zs&kJ,=@[user]bX[/user]/o0>=QbDQi`SQ=( F%tlPR[n./ZBTOt:XgDpfQO%/2Q:tbq[JL3MH8q8XPF$?IbBCmcL8KF^K(LbNd9r: +nsfI&Ts4l'JLW3!Y4S[ENc8^'^l`NHe`aN%=i]=r!3!s(6OGWYagrn/L:[?WGH3G lPN$u_%4$)-eBp[oV,dhU4B8>5eu>#iGnYjDM_^uO8GqJ7pDfkm)u[!4fN^aZiR=B a8)M2F(TPD[RIPpN&Ig3C&n7>?_SPZbhEQt5#.*4ei@#mFsqd*`"(aR'/qoELM!.h CWZ3'Wm&iBhab_O4<;TC,'ZeXfI*G300Z54afUORWQB5=W:.!7OJ-/V>0*G)b[+5I (.N)+q7%rTV.%m5_r:75qug67Ao5[saj*e$\#U"O'EDpb&+5'E=[WGq1mA.>[O?tG 5p&(Hp@\(.d/!8FmND@k_P7/B0=Rm1a7G-`MWtZ,.]T1:jV<"&fQ:upq=:ln?IuWj r<(93=?75P,'i@$`0Yge;qE&1$'?11FH_f$7Vs_">#`Y>U>600LY0a!BM)tG,p<CQ ,Ro#1iqODGnM<r"l[.Z)SG3i>YnK4;Grm0m&nlk&O!5DeV4]PW%+\$&C/lTXG2/Yd Z#afQ7hM3@5GnAu*Q@c#cL:Z*dJI)f7Zl%R@e-C$IsOtm)52"H=*,T;F'(#[k-Es` )DhaJk9_@(,7[F79sQqCd4#""Q_jUHakb"*@[user]1\Ca[/user]*:("4T;;^6<foO.gL]n\C@&oD :*%gI"dB20=@[user]ua7gtb[/user]6@XZ:.%6F^Gji,R+Zc;5<;_J&uqiHM0.3P-l*R^fq&BbW"( b"<&lD5h-J2>+q%n"L^-3EstZg=8Mgp%L;QK8@O3"]O6Ki3?U6j)n[oF<;F)5gqr- ?mA3f$o[8d\Vih:L?eN@-_\O?\*qV-/0l&I^Sp/QWKN/0$@[user]\e^[/user]=6VF2BT;Ga-DK]S ZK]!3"nM$DajAf*ZA+a'FTU.+dS.SY:?esBU*.42R3)%];F?K]P-Yoo1hQTDK6>C7 :8`s`0eI,*DOVY"`0<rUQO(7FJs0.ib[uC!kJ!:fWiHPnl"Jm55aHCbOXc?RUXFDH j=3/<0Qp!NgJ7N+g3,sLD$P;Z5(!-?8!fuPIC>#7@jm\[I4O,Q(i<#(D^LMC7".A= _&Iq##\<GeL/(>O*L7c`%GcD'5k7R6"I`-VXSaPC7:cAFAja%nEeQ>pkcApcS3ge) ]X78N>(.D)oCAs\F.@(IJ&c`![iiFg4rPl9hmY,G"HCHT$>Y;I'XbHTI_ILV&e"$Z Oi_h@jW)D?B_(YPl&#"1-sP9+IK-_JCTi2BZfSYJ-FUCKDfr?Q?Q7dXoHnELXc`hQ Q&s7^Gr`/%kLiZ0K)N4Bm71/Zr*S2SekbZ\n\Td]+4Gi?=S!_4fhYqO&N-T5i('*q F*5d?*4Yu..o`5eWH_E.V+^"r8M5l6;s5,?-XduBo`)[keo'o\Gs0EtF&[g#c<R>W Pn5#N.LP&Pfsb'jXkGPOCMaAa5[QEW*&W4TT!k2*loZ5U#bK?cG8Q%t.##jOYXY>. 35b(Oq2dsBY'pJ9ckDU![&VqBDK$OBebOpLAT0)__!UW8Y9)P--4Y7qD@SgToDl,C 1Hr`3W*!a-,aa,.P88D5!InCgXqG(HmgqnH1Ib&*O%XL`\:ARmdZ<I"JhHQ*M$0#e 0At7Zg4#T3cgCr=Z[76D?=M$tC/RFXQAD[le>h#&#4hp\hZ_.k%T%.dgjI*[[0>Ui 1%/6t=cT[6V/W+BlBUXO_Z_&4X])_goau2hN@Q>W#kc:o!a2_<ppdn_1G"82i6,om h-VGnMR6]NIe2b=@,[J<hKW8@75=<V_)QHPH/hWcNP[\om'H=%#*:ciJD5+!@[user]g[/user]+<? ')6nX.9IlBq<5l,,[^?#K[A19S)[lm)+2R?@[user]WV0[/user]'HY1O-g)u^/jqq5T7i*pNdh[\T >N8E_--.*R)r-!iG75a3=\;RdC+3\H1/(&jBFNr,]nhDUQA/tt11Y;BoF6(8GbgF_ i,rr*_7's<GI/P40!md\9qRk,QpT)KEtm`_\@[user]T1LEFKSD[/user]%%4/)lA+hnX$Rs_F*d&d h4%3-M+/Y(Rs_,qhKEd4ZAmluQ"1`[1?:OZs$d!'DS9gC"mP]_L43hSH:BF?"B*JY 35gWH,Q?aX\/#UmY7_X(ZF6oi.D%>bpPJ2\rLSMW^hU)9#+!qH$29:LaJ3Xf?0<F; Uo3<A'p9K3TN59pdqb@]-bhVZd.YYPgjN1>RbgZ/TKb)6O>U(k#F@[1F.N]Wi+nX9 U8`u`C*H(5/OZ^pVUeP&RUbJGCXaCBo#3`]Hpk(Db=&dpRZF>sT;:&sC.HcM]2Y&] b"fSU&&DVij`'J#9S>"aA_rApH1(r>_Fuf(e9Q#@#SI;A?ud.U>t?+GWqI4jei>\g XURRBr%Y\6nMe>fJ71>;$0K8#0+q-<5!j<p%3EnLTYs4&hu[0E!`QH6`6AsR>TfNk Bb[58ae=f3[NcT%Tj>IiB,H&O$h+[-jHSa`=hLUiEjQm`2I<_Qi7uJQD/+N`[EdQ7 0K!YV'Y#V:Mhl]E,nV:gI918"b;Mc]Q<HAt\.PlKoD72h%[;geO[]9?m3.edN\Yf3 B-n(QZlE&n*iDG,p&[`Fhd2+2>.<TMff<Ef<i3uCoggdIAk%.1Ce;6TmPZb-C-p-" )1f.<4f6#g?I[[oS+];,Be=Cf#&'Rd0m6358a$A/*1d4h9(Je*J3UIT$eZr.>!FEO P4mb5Nu<DN:"u'l94TT)Z'*V]%hqb9=K@K05)>#UQnI(3ClrsU4Rbq60rpn,bI.]4 ?(dJJG!rmW(-c]VhL8peF6>&(,2PU!T@!(bj^kX2*4QZ"KIOPEKn<-fCV'E5K*U<N Le@p(K\M2"$5m4ofe3&=)9enTZLh&uDAR&Y-VgbC!_P3nZ'IIX'&1*n$.LTe4^-Vn ga8XFfe19Uq)*nj10?Nf0(pYTX9p2E^)/^d8oG03bp7Ng3D*fDbLU\1l/@Y)gZ[&< McEV`FKnH/9Y2O<Qb6En57ur2q9k/U[\NXLP0S`L=0*fS%C9IIjM3(S&+IQ.e(mh! q@uP2Jse5,"[9fNQi#!?[DFV-GLauLpPlN$]-:-\,k*&+DJKr]7hReWIJ<&_%H#iV g7OL)`/j9bB@;SH$'+M9247_s5<2DbC7DL_5t>*PeMO=TqLbX\KPd8o7Tl`n-^`(T &i;?83g/PpN07?a0QP:4@D/M_:=t%,e$a)I_g<lMrqF^2P@u5qWj2Ehm8n-M./I)4 Yd]3F7O"+S$,1t>5\(0&Up@bcNRWRsCst9hpg]bW_Fe?r#QZu]0ifa37+T-oO9Ltf c%!kkrq2a<X?]OSRQ"@[user]f4Z[/user]&EGbM@7/0TX!K\0*KRkHHht*Hol\cp4#AU':(JUKN(k mg-CcR9:X>a!6cM&+<d.ChK[%=40qaeogs`dm8'^!n@Af>.pXs,uFtKdPaNbk,`&^ P\+"$b,o_u*4drhc<fhIh]0)6'Sd%5Wk^4"TB[3s<UkQ[?hRi$h00jj[NTkD\hgg3 8:#/KSZOrTSl8]R4'H:O[:nqf,-?Ar5SQMHa,gi<"qpKKn+T$,-6rVD0dL-tGS68h ;/8V9+[2Spf@+X1(Y:J5ChIXWD`hC8ZgUV=C,bnAIb?r)c[EPl&)Z"%i*irM?WUL3 e<UXtlE5^C@p$q("]WNANB'<_J_!41b>^_5XE`$h=T#Jq2=6=LS*3j/GK&DaAPocn ooHl)_bl4K9i]^4bhiok9Eb[2!Uc-<N'2D@2NZ\;d0c1/2bf](2NX]=9bSJeTYg.Y CN7gqlblM-0j8?D7Y6boZM]j"@[user]3baumFB-i-si[/user]/21F"=%4c]Yh"Q*5];@[user]AFb6[/user]%;)> TVJnDM?Zo9qNX$?*VW5jAgeC3$b.Is*gIIXUNUV;AptsiYL*K!K2&FZ&p@Ba\S0O4 %pQWXQb`q5==/S8%.ci:J3TBTPdWn?H,)$,LO&gQ1VoNOWq&cD#LLWg^O0OtHPC[U E4#j[&Z?[EaW),l+b#fO1JrcGa?QC+ZI-;sNVcQ,"4Q`2nF*dPY->N0BK(q8p8ZA_ "J\<LQ-7:T[<YtKll*L6YN`=:0DP@YqJ,X)*L^@[user]6Z[/user]!!KKA=o,JniA.tCI\)1l_=Zs 9\NB4*DF@3ppsIgP(k'S5=iD/p5E1\fU`iQg=="EkuK<ShP_23Uq+qE,N=>T_+>QV f`n(c=$L/02\C!L*0X6R8TY</BR:+3Ta8"DCsXsEW><_Z[.4:WgN'skZ@!A]Xcn;) ?/r*1fa!]0$khG'hh[E%eFZ1l:b1Q*qMcV*,->glQ/4kN(:n'D++';l-U9![7NgS\ Q1%)g;2n3o180J1$6?9MGI%i=?.9lC2<PX3(4H5PG#IqG.S\$!=ncLZFb1>F_4Iks s/H+EeRKfUO\]a4\XerV'bfqIJj0s3ClQ(YF'a(Gi\-2]D2'J;I;&U+OoD0@DDdr+ M"I0jOD.+LX"k\>R/P*2ZBWk8Q%)t?i8NImN>6qK/7q2T;*M4$!pFc#AJMg[0/cGu 6+#XgLWuCH0gL[%/E!5=$fF(+8Ji@W\UF]$Eh2l^gKP]SNZMYX%8p7_$-B((4_WgM ;J1IR!P!$%=.B6V&hB>-;o*%TJtc.*P+JVXB0*7pltcTH7O]r,9/X6dkU4hO;>Hai Y)&%XliY+;C`>ZQTc0+#\7-P;)_H-m`;nd.g7k9NJ5$l".=.ig'Cp+>G%Z(d,NiM> p.e/[<u+dih$N_gFi*<0;m[4R...3ubi'hb_^sE;@,'s9?%]eRFn+mZL8BXDe)_Is fZ!E?S"S(4Ik6n`E@]==RD)ffoi$bo"f0hk'>T:>Dm0u0ag=+CES/sdG?HtdN>-3f qcOuS(r%0[A149@72MF^9.MPrG#%/(7k^6n6+S/m6]glM8Y<W4(,kgKo!MMG_7Y:O Qo=Jdd@#%U5%0$c;pN'&WAnAVYU%HQ,lS?RIoOfp2hIrhpgmu.-?KVC\5okKoML&U Ol'u-:>c<c\HA3@DOOHJk#_8V-CNBN4hP.&Wb5TWm[<">pgscQ&B0td%T:bSK7rd6 %hE^u+4oj#E1SEO>0cA+fOS*a?`[$].s$j>FI=AOo-&P8"9Uj_,E^k%.$pVXPQRaT i)&2rNN?#f.7WpV/fG]Po4`'LW*4<G(53Od;CuIgK=-WepA/:^3J-YaN2fo/n$/'b 8#s6h4/h"G[,e2`;LBKu_5d1RP;nu*7i:/N:LV=6ET6*f@giQ$@=&?6b(s\#NF'VA Us%1u<g7h_#D&Eequ=6(0F-LA**=8k;:'a:2&PH5&igf'*-.-WYfo;U_=*!a4da,` 9VZ3lDX,=fa`AR#WAi5Os403W$V6!5p_QSII.q6_Rj\bk3ZdcMX!DP;D-V'RlIXc_ lsr^/Iq6LFa`gq"9EaI.1k/,8K.fe+U0fWsYsM/T*Ki$+=amNlj,E\YGDP\)-)@[user]Y[/user], 2sGI/n6n]!mXQ'g-@.,4"(AIlp#^'G),X(nS6[A=BJeXaZ&=ecl"'(K'L)6shejU7 ;Bc0#l2pMLSAh1+H[PS8R8]di5N';]%14[7RX9G\];Y,ZU)B^YX=gR1E&-8<n]$NV lBVDC5%"%9Nf4t&5r9B(UU=bYRZkHk=VM.nhe7B7`I0-X,4FX9ArPE%mhuT#P4Y#$ 58B5%Z#$a:OBT:@[user]s[/user]'H:p87JUcl+=b=a.@[user]ck[/user]/9k(XP[-koq!S#@;Em^`Y^KtiBP<A& Js@ojr6b(H9.iFQ+UQaAAJ5upKf3"!l[=tpJumMSe5Xk8PnoJg;k"u3E6dHW?^o0j S`,">f@Wq$k<.GGmlUKLYNa70;bl[pDX;.<bh(43B[Bgi6(:772o:W*Iif:kAFiDJ W)>`f9t8tZp^bJf<Ghi=Nm*]X!OonmqDS?ZdqcOhVpjNXB2e"'-4pe?K9e3eg10\; KNY3J_`3g:]I)mF&3lM0KYa;Pi)?IP06Rm**/gsWE?0Y/@?K;m#)'*HeP0?7(-,P> a!3b@IdPQ-5cTAqlMZ&UT-,R4:B$YD8Q@^HJ6tm[eU4rl<8-sBG?l@r%s>%pB8(D# IW%2"$Ms:r;<aRoKJaDhZaoW1:Ws"\[8HO5.3NS>h]0F'2b61d8iK9=@[user]h5[/user]#PC"iQd @[user]F3EaluY[/user]/<gWW%]6RoZtQjUWKfd`u4_/pC:JbseSj(KGI1b`ID2TBJi*$1(hnM!B. V)Y!ij)M]WJrl8Eh5o>@[user]3L][/user]>Fa[YsX.M6n7"qJ3i]20Kq-DMC=8Yon%.VX)ET+O_> `uRldBX5MNk%8PAkoptKN#SbPmhlF)#0Om+d.a>K^cgVXDtabuIAX&klY[]3b!t]a 6l`ft<IE)9@]]U:8lA(YrKHll@JcX"X=no&pKV,j6m%?PM^Y5+7"&bpiAOFD#dOng KsuMa',T*aLfsF)d`Xe^WUgPYX4ZAJ.++p:,Dh33'un,5=?!Vr)GgT;8OB>8qaD%t "DG)GaPBF88K;*_`Q,I+YnLV/[R1\o";?t3.-2'oK0mU:-j7@5'j)hXA,?A-e!K:) [(YA%P;oDC:&EO'eiE3fIGX.8hIg3%T-J7tNF)[6:Se_9Oj>R##!.3RV5DTOY>f=4 d-5q4%aLs.T"oF9'K#f%^k]o=;gdpbjMQh%nu)8YN<aOC7$Ak5#Rl/$)#Ps(nk=a) ^<LNb?>U^e%[[I:i&d#9$m*Zd9CU9P>c"/ubVNG*XR`djQ(;d.Mr=%kIG@CJX[_== ITH[MrA=:2;m!nmdKR@Wpq,+%:qcsGc%WG^km!3o.nAnVPeZ,2d01b?`>ScG,@[user]_`l[/user] _>MkcR"\[Bn02JTe!XogCUY[YI/q>h:+E95h?gu\JoUmrK2]PePJC9%bSq$U$g\*d :M-5GZI(?q0]?K9e&I`Jq,7,6hi8'me2Qt@@/*>m\K&r4mrB^0@ea]+=u:UQ.d"S: 9A;5%*1e5!n-?<D?tU8c464(l7p?5*BBg+a^E*fU`1-OW!9T9_3?&k>.M3HH^M(n" Si:<:;Q,,-N_qm9cWTXbe<+1nS5Br@('#u,j8_ko=oFp+c)#E=U[VM,iK3\5g;:.! A#Pr^iut"/@eD#^Z8u:T-Egh)7]K8Mgtsa9fW0URYQm0Q'/iCACRWb<R6hLC=fC6) 4W6hI94%"%o\[#Ir'sH*]o%m#[8"W.nH]Iphk]R9)1cfX?c6X,o,*`d;iZdm7?k,% Tq!&/<;Aa&RZWKKE)S\9d4\m#m^W0ic=Y^lQT"d@ecj]h%q&$_puRPQ0::IV*PMld ,p/=&l"npFD98BS/=;m&P>bD%-AlCH+#^j3p:BG;rr0:Yq%8JuhsfKPjhhaA6],NL GV^$uqcP"!9brekA$e):&"3CaE7[,AOQdEAPFi54L1"cQ/Ap?h%J;nMddG1d3B-Xe 26:uhm#iI[$)(-42h.h&8<Y=!;1]5_3/Zj#.!1e>WG^T^(2MolMp4E0j:S?D(4QVU ;tZo+?=#!kD[,mn3LgiI;0\Z^/+N5[4..(UCZ4USQ$phdS&BcJV$E::!iN]Z;&6eP --+ZE3ZiEs#p#'$`K)o2]?!M2_t2-Li2i\aVq.uL,s,*;4-`/tV>*C$Lj)Gd*^'=` g@eFsWV;n/Xk!O9!:82hm*sH%*d6fs\sA_+mphU5)u`1\cQEttTA#\D<Vak\_L"l5 ,VI_g/s9=]FGNO@g]`a(5`'6p_XTKuH2YlX0tcAVONHA"&ro"<Y@u-D7"-r.DbdlO $(eWp-VuS_E]"k1P\_u\gi8%3-!rG4I(c53/EmhWHS(IeL_W7U$qodiIgXCS19HC% GU>7%%Je$idM#!"l`_QVJcO86B[o1]*he?.2La_sC6ul_W#F_XGmKN`R;rR-CRkK0 a.Xk1T&E@j7LcCDk6B\8>V]uu(bL]K7AnS#EQ&ps-4_$4M\F,+daOfU^W;2d:&?H0 ,mUdG\+dWegK6mZr@;UNY!dV,gV^HC:imNNV',u(kmDnY+qp0T7Z:%,Kd(4!T?%>* .\lN-C:`UoQP6*O^Ojd'NI$SXNg$^/g&,_*rk9fG>CR+em`E*-rgKPcahcMPcEHi& m'">$fEr6)-H_;[j^no@mSAu"?3\T+;F,o$d(Wi&frd:I4=qO3GZgBLTl79K/Kq9X *>2-"GuU+o2)a%eCs(D_icYl_6^DtXZ;9F#7HZ'6ULhZ;c!5\A>;=.7=W"4#rtP-R oM6q3V>qEB,F3C/*\Br*ei3\5@Ho6_f+;l+@[user]ir[/user]*FR9_+F)+:W@#/cqS*1tWoC8'6? 7]fp8JeR(kXG.Lm^';ZE]u(Z-ZKPK$_11cZ0R-qGY^<DOlj%=qm,D:'7PPl%kubX, TFDfF)S?/[LY.Z1?=q+ioLtV_QbQR.aP_>1)1\8NH]KMh7YR5G_n(d:]jtq6re<7P Ql,Jik>,F<pqIqbNiI9`aPmRNB^UDDq#q(nn.c[u]qNd,,M#&eQ^*LHC[*$UcD'X< ,\SYTJu6$;WWf+o0lfgO2m.aHD;b*JV.5Ka_@[FY3g)-2'2e[-Clk)he9W=LZ8MP$ f`D.`o\Fs1#`aMr\jS6Q75,%e[F9a;eth:hK5!QdT$dA%o;9k[(o"Ng%/uh(Afg=K '/85BAe;bf!K=qM$/Ibip05hs=S-bt+A$rdn5E.gdY18:XmmscML$tJ$rY4R7+k%a 2jtUJ6d;Wph9A."#YE]4a\/M\p`)i(>9Tj62lM8P<ooE]ESDV57]]Hc'On'IfrQQ4 eu)IZc8BZCMH[1<846-\C5'\G\-+NDf#nLie7rK@,c2&RqfJ_m`@[user]A[/user]<rp4qlj5&=51 WgeqPjQj(q]MBlUU*-=ZjCk`NndQjRl=D]I^+gCg:+nON=YA?JU0QNMR'!mP!b/<' P^=R;J,Ii3la()kKs`TM@uEf`93d'^)5<&t[/;<h&6kGWM-44!#q_LkKCr.pS'Wp) =i>eJBbG]eAb1RqB\?&N@BjB6!`:WXZ"4-]fV2s*jUE^jVPJSO<7RT/:JoZ<;l#Cg d!):1A>U#YV9l30IhOVUKcJFY)n@.q.At`Tb-]mJ;k0R'm:EoqCaEp9e]Eb3goijB i-f3u6[lDE\*]RFA!1h)PW1&HQ,pHCa+d!^?!n9CU.&T)WaB7?i^Rtr/!M`@)9Im3 -(ueLKEeC?R78Krb(,3Pe[c'B=@+"EG8hO]SiiB^Lj/?Yik4>%BVo:!'+R;4@=i6< EY,D<\Qq4M8ZFFnX[?VN"G9fV8KsBbV##mD-&$SB@nXZ]d#G;);T.<<cS;+LV!'## OAXF3QB<\U04T\>Pg\"^a-+h>\W5E+6Ag<jZE7L6R7b/0*KNkGFM*A-,QH-QZJY%8 YFG;MP4J@X/V6*oFVTrRE>#o`Gdl@r\_0r3#etOh'$Q:1YKO(hh52R$KFcnG4HQ8e 2#],BS_r_pJ"+9L2JPKo/TAVi0CO25g2@Gdcfl]M%^e=@R@^A(&Q&8Y=03'e6oD"$ ^/c#qjf#QVaB"\VL@+;;nO3koANREWn*!&sA%1ZBh4Hb6XM(it,T$*\b(H*TM93SA 2-Qr.1LBH7;-eB*2I6&\S]l1:f5,W"h8BQnLt^(K*SW;K;aUmmN>;YB-jhA2@?F!E L#oS#bMKpFmlji]fnZf9]GFZ]$mLK5Z=o5c)R\QL8NWor9Jrs$a7O1ha@spn$]<>, qtHXCoD9TDht]H;5O8$bI'/R5Rj)In_aEJp@Bl.LLBm3uL+[7i1WCB>#7Q:JG@_"g ,Uh'Y'o>.Xm^#[c9KRWcVUJ5LqonSrp["@[user]L[/user]>)f0O+0h;XAoRmS3f;LBi`^p]YHT1s @[user]XPtuJt[/user])*K!!/Dmd0g@H-1t>j%.4o)7aTkL\)"4O[<Cf\l%hA)b3^0PZb&fkX.Q]W iC\$RVI2hniZduG&8#)LSfUY17f9ZLs-idW*"A4n/>"]np9k(nEP'4'DquEoImn[% q3i&';:-mXri6aI$K#l.`BKp2;BtW),NUM>enD%_&cakUTc]/)^E7W\nc+f'Q1Oc4 3;fbQ]]\64EqlQmr6O=$qa1(IK_&XpDk2Na?NB!V*;H$&/,HGZ@0$\qHcue4N;[C$ 'EnbSYnas(P?UU8+#'^6=orZH?j52$0T-U(Kpa?8HDa![I$pB,buJ,%.2G+CgZrK5 iC3pXni'3L"1_.)p2Y=*[*ET?o:iA-5a5P-:Pb:[^;`;DcDr])-9ZNiIbUE^DG.bV dB\o?_dY2:SI;"c@toC@WiQReO8GeGiiqc/6NY4J-G^=)h[2=kBVQl.?R/W0>!'-u V75Cj#Q]G*6P*_ckJh].XZ!]2(`@[user]Xc[/user]>UdU,M]_KsS%s`5DW4X&E@TfrgQ-VbDk%p' 0fO3g]qFc<r4:j\=`3&A=P%&GnXk'1flsY$V*[^A%Rr5q4#DF@hSTQikX]ltEr4m] 7RNRDA>,_I7^@[user]ro91MX[/user]);d:[\4>b8]_@-'&D/_,(a\OU9"FM<Z+L.EgGRIr0O0b%' F-HU.Ru!@[user]iCa[[/user]?;S`%]Rqqt-@[user]06[/user]:/Nd](/DMkPj[aZ12J:UUX+#-@[user]Lqag--^fX[cc[/user] Ue6`5`4PIYi=kQ6%aKK4]_d^AE8S%1M\do^s!_F\;*oL=/%4pWQ/3u`NPWs\j%.FS Z8?A(O\q2GE)[C$.5!(a<(iE[(/Lm;Ru7UXNsW7!5@eUA6q:+[fqaiI1'RHt-o3<: lc'8pG!7>`G48(sSS>0hqOHBM:>J`8:+<:rhQS+O!#ua-n>jG*6;W8XQBf='MkHo; cO0>DFt=Pj%=a^lrdci)N^XGBQX<Sc!HWeu^Be"Y,AWjiEI!.0_WH?:9./%s=i:bF \6M1@a=rs_1]/RiHusJH+lg,OFJVC8Hu#<HpU@\d*T<jU.(BFU\pF.kG#`<MgK'SR 66".Y;R'i@at,.8:lSgJq3eR.Z'5R00)0U8_hi;>6$\q]!Cm%k*#6C:!gW+Y+aK\U 1S5$OMl^VtRc,_uVsUj*9^eb8,-%Uci"(ApeAo(OD9!YJ*UR@CYh1[L%iJZ+dQcB_ :!fq]d.bNnr.^5-N<)ro/j8CN]8g[76!,;9[hX6)mVHg45=@@[user]G[/user]#:fZ*+gnV?Os_B+ kYCN(o3r^RhBI9kkl#mT6PDeY-"q@HSBc2KP:"GU=('b0g;Ps\GoG/u&)[HP32Xq] 5q-p[*Y:/fB`=hLdgUR#]pW__UM+@[user]I[/user]('-))!"&4[c%fCF^=\r*8`)t)Aa,FONg>Xk C[F/C_%:"uD7V5Xom=-Y<As5s,\oG-]G-+ZL\Snhr^R'[,0AK<2p74X`<rtgP\C&= TQ+3<c?\W#P.ohZNb6sd,@&OB7gLr+X$BsF?E);;)"R"W*oe[A8`=s>JD8tRj\q.V FCl*CY=H\)lfC^C&ep&V>eIIX9+_sGos]^pn0R$4.WdZINQQKOE@tEUT'4e8hkReW 4nL2s*%(K]UCS].m!a)*^,O):gNq9*UB?c5R,ju>D,(^i=7hpP$eIp$%3LC\8o'Xd AD-ekmGUU=j@I;4dYdrd9>K][]]-"3"^NGV/X\cCV>^RAUfgm*T?@[user]n[/user]?$2^?09q=rs 9hZB2e[RIg&uln\(Ldnm9q>O^BQ/YVh*t)m,8a(f?&[>Lr*5kg=6HY':\N6XT,?=% jm$@%ZBq[,N\4Fa?(u?#]5t[9/Q7mpmOn7u#"shH./<n.0"OkB;);0a$;3dsE,dH? VpR"&$7c=rU>CB%"Rr;XR3"=pHL1P:BVH5,WoED4_p4O+%E/Y#bGAunXXaJFhen>! #R"[TVES'q;!O;uVO&>Ss)[_7k-VUs2leb'_prm"#\\f;8HhXt1F6j0"e.+>+N7`S APjpGoLQ:&_`,dN6d<VDP3tomiKHto_XCUB@9fU'3670S:WC<u-H,9lhfnJAKo=F. 43OC#rbDD#W%3r(B[X\Rh$s1g3cY%Fb$?K>B_?Z\"#jo?X5[8?9OK)ZNu(Vbl@b)` 17m*h;kGX)j_YH=FQ<o!Y0S6K^g>Gu[TLHpfI)JCpWNib>]c%6;bVlK-3)EqTMFtb =^3<9a[.ohS(0LRcd`ZWoi6sd.bn:7$ZB600Q]'u>LY&n\Q,8r;p0G\gRi/*aZ`k` "h0EVm2F"H9sm1@kn989auP89MT2YdCBeR1_m#EM#D_e7H()jfkgAJRB:/=29Vu;H ^V!6(Xl[=:c[qQdIWf+"5WUZCE\(p)TaUK2a#&iLYb^]a^9!@M@C1j>o\G:uh/3F? =YDpSmC*ZYJ/Ya.)_P#<(UOC\MqM_.Y]2L8+sULUR,A.!b#FBg<M`8gr0%,sAtZPD fs"u%*ioZ-4Lp4si_!NYrD\]a+Etg#1dBN>"#JLo#;K^u[R'd5Ik+/:>Mp#lH)lO^ :&Gdjjhs-;+rS@.2N&k*7*2bh;9,UKMWiGeIp:AU9n;14H<elQ_D*pq#[_*[loFhE %$K/o\kEi-..mpk:s=l_6R$Oc]/)P1B@4#R6NkVcM58&J[0>e;4c+q;4pSRAdf8Jn ;#uQ(:CI;$<<Z&/Q)R*rEM-@[user]7moTLDmkPDgj[/user]#k5(S<U8,UhQ$Q*5PChe;;o_]1uip T$GibPAqtqjDsU+(kVo>pEbGW84#YklIt'4=8.7kK+K0L@1W_'`(,JtY`1YHO4uYa 0qGhFoGAsD:,AI:83^_?Dcc^kh$j<uG*h+X^<cD`^6\P:;h@$uS8o2]LQ<\u!"?nZ [kL;A7k3'/ELOp,U)d&G,HZ:tF\#;SLRe`Y_X"7OQeJT.&%"K8/>/6XX82<6gT[%u 1]0]9;:d(8?tS\s4B.+-A_,:>*B3X/h5lf[0Z<(f9@s@D"i&nEkOt,$-.qG)/Zn^0 Ti?JWY\P-rrUDT50q#PqH2;PnHf3pHMiI`%cO2&QO4pl1X^ocrKgjYiY2"1aHqB;W #"@[user]^][[/user],O_nST%0ZG-Dc%h]X_oe&Jj0?!\oKe5/"^N(f+H<X>JDlBEn=mN&Dle8Xc" IjqY8$#Yt-Wsu:DWsD*H!b$<X"7[6#*S.Y]<$_Fhh<R[Xa1_K;;@[user]I[/user]*"-J*e>[Q5E4 3,aS?&S;[I=E4^1l3&/WO[m1-K8LRQXG_)(QCpH%A"B:U>ZcqFOM\o;p6A%!i>1OG ("Rl?6Rfsi8k$bn[V[T]V?(9K63(m[!X^V(l]uL,)^h)%b4p,NPjO&AcO18d?"%g$ pV4;Y]L?47+Ym++bR7m4h#d1X@2^q/i!&8*S'4+RM4:7U2b3K^3hrY#\X51F))XGi DHT9PH16c*e1kQn>6lPa%?;_0YKT'"!lkY]YmL.o4Y(I-0\m`B78Mn!3'#&$_7`]A 7fp!a^o.A0`f<)3XjF/aUGp?h+GqZsJ"<S'U2Xq^A^<=Q(J815@+I&ieT3AcOEbP8 %4tV^?7.nUS?SN"9Bde@rM(*_lBACZl>;)T&n&!";Qk`#gn\DJTGLn$as8p)0rouW XV+RA':]^u"E0F\+fK;oZO0egk(-2.CBQ12da'_S#--,=U+@;lbKK1CWH&FO-?0Q6 lCQjb7HZCL*:CU[g[7-7WX0'E8$ME0e<F.5V&JpPo?n.4;,>&EFQf89Y%F;Hr46Ub p3TT`:"\,,$Qo]Qi%nVT7+mG3=LO*-;7<o5ft()@[user]WaON[/user]"Q\9*p7T^C/OA5/,//?Ft fU5h9b1e_a03gJ"1G?AW9:gV/NSJ0u075'u1AHb5T,m99_N?bO(J@jTo,/u3db9g7 HURu8M_S0'_NHa2kW!ooIn>pjR-a5[W>ql6@&ng'1X)*aP7>mk=q%m+K]ZE!c+=Dh ]hOoUG"Ia?qqVQ3@HVn@g#:;g[%=Z#,]+?Os-!P("3<qX@>Uu4+.BG]klo\')glsM n&45L7>jO"=2e$p7I4]bOemR;&8?bQZ[0N-]`F<s/N:G?Gu"$k+eQVaBtBqm?HNH' $24QR_b7!!2hl($&o8<$l,?<[`.,]QT47B1>T$<O[W9>t7HIf%eNJ>EHt#qqIo]Yg Z&Mf":.[0E6?Cgkk4V::^$4A#OiV6u!b'h@5/tL\\L#9AHqW`G;#>oTk_dWQH`X"; `CJHq)L_Q:ZsCiO6?\rjMo)kA-j*3@pej;:?cNrP"?'sZU>jB]K<*:Zqbdk%S70Qj Hl&!-n'Y9E@aInA[-8<_b:0eICXFrEYP4#FjoGM.74hl0TQc7-6uj:&$aOR+O!VM\ 1QGe,7H(_9R?$%a'rQ22;"$@[user]r^Sr[/user]#s28jMn<!ePS/[acppMn/7;3'5f7p"*_2<`GO H*L5/67QfjSK&EtZ#?0$Kg0,#E]ek\9#>LJ]W;6h$CLj4'ULj`#,jp^.ndUu2SOqf 3Nie>%tAKr_uNTD7XT2_a?=@[user]11[/user]"Il."p1?J1QldeR_]Cab!ndpG/m'=Vh+=ijr,,L _)W9Pic)#4JFQZ^AMo3-s.$KTN>qbS+)"jn]))A=NV%F#0T0A>nFuPC@X?c/rdKUa (_V6Uo<7l&nH%8,0mW'fAa_WFceoJD90>LW2t5R3(V/jB/_"6K<4gSS1!9[C&3XGb U.K*`S\9m&LanhUXX08TJib8p;_]].'DB'sDBHE+.m?O>R&2?a>Q8[',`Cj%HBfj) i(o'sRHoQB):<Bc^4,G'R7H[R*_eFta[XP4Pk;%d7Q1qE)mAI&V1'ja\cmLPEn<RA UF5Tl^MQqW]03.rF/HQ>oiG&J+1sb:`"shTqtD^,T6..Ej)[;%*@[user]eFrX3lZ[/user]#YP(b6 c\$:deG?"on94mEaK\&5N3kV,m]:/q4$)[eaA-\/'/=&pCMWI;'@[user]YkXR[/user]'pXQTSst1 EQ^LJJSJP6Q9<5^Jj/IU?DV/t#gSAM!-6bC4_T%"4rT$B/I\eVbE_RQ"Kc+iZ.r^2 (kC/HnGM>(%Tae9^7t\"H?b:=\,0DnrkhJN<r0CN>+sYh7p#fFgLpSOP5K5R1^C!4 ?3Y33)?#>D]^"lHiu5<:g-=kAG-4AQ)24a!\X3h<1SU,?fe(qt["m!(%Qi[Y\2hdK 6]ND(o*]7Ig;bp7H8agUe1ku4DQ5#LlCGcUR2fbp-b0QO\-t"-J1+kE(@[user]agi[/user]_@uA] 69KNt)GoSgT)QX$;u#ZSKUJn%^csj"6I$-id*kd;._E%JGZV,sZ"(d[]IV,?>sm^c l!cT!JtX]OPoj:u"KV3q<iXu'^h4Uk`Rt8t68R_]9\&cKL<G5B_J!j"hOP^)'fO&J e"b`(KcZZ-M[e_:>TN27I#@[user][j[/user]$`!Y'.pc@_i#2o*@[user]bbWe[/user]#!DK2.YH@@[user]d[/user]&.64Spda0 s6;BckYo>TVY/W,?I]9:ch"Jd[q!K@'KFls]X>t"X&l$tdS:@[user]KFkQ[/user].3>8);sm:/GA XHD'PFJR47H'HTgLMnrQ2J9->9BcorS9,>?qd]I>a\?cQH%G@UY^cCUgP@U`6u:3. i$i]3m1"X6(jsO`5^P#n^<%/f:t^/Gm?7raKt$Y0M8-p+<`0iogs6DX'=KW4;Nhf\ 1SPrj+6d>XeE!$JnbPc"kKrXW\t<Fe%G!r['uea@B5P&8AOZ+j"Ta`QTp.>WKEQ=X KO!E$K/3g*#[k1'=9P]F@RT8iO'.OC?$0qR4_esu4$1&ah`,QRf_>9[jajbEqfcZI G^o2R4R_m[Rklen4(.6'D!BSSR-gV_r'o]8kFqECqtCO@]mG6:pc8ZX!![Bq19<;` OG"U^N-SAKPRBH8./nO3")H/mrVcfuPL$-J:]/2K;:XqO?*%Z#l:CPEmu<:#)fa*W a;=q?7'l^g=V.Y]&hqB-^KQ.%XhmO1C0$&;Up,PE"o7#V5oE4UP(Fsl^lVKW<;Vt; ^WqZI'M?g+j^aY)/42f=baG=BR1Snc@_,Q\:>IN`06c\$Pm51-kJ[q\LZ?KEn"2iO r>Q[J.6=.A>9-elBC2](e7[B.Is)!dZAThDA17j_JQu0;A(I=N='dI>0Bfi)c_WMg cgRu(.E`3ua\X/X.=$jZfd/$MPEZ7(E/EoMr3rcl8"FYJY6V/(hD.JGHi@4rk+*9# `PJCb[iBq#-,.=5;Ma+pF\!=Na,Gk3L0\U?%%Q!t4AnoB]jukj5VHLe9d%N\r![Nn qHXfNV=l&)],'aF'Tl!Sa,3aWVo!uSIEp+of8+G;N9Vd2<"Ju2Bso.nD,ufkoP;DC *ub3+NPr$77Q9KFN"<V*&S$CDL^W*]^%!s@r0H@7`QQ4,]ges8d+rA2=U5>c&K';> fNh/k?%CdaYs#L#c?\O8Du+,5n"1QBXaX6QdV((:'nSu('-Ch_D31HOTD?X\]rZ]c EP(KUOSY8$$1(o43`RDi%X!i^.I/SH#tqRu+P6@-eXnB;B#;7[ohI$4"p`[m4\o[m O\[IS20n$`4a=qIZ7l$r>kr(Q8ZgL7$XKLu2WsO-RrS_,NsWp:!jppaim9aE6kpjS -QbSo247VQPfd0FL?Z<9rp+m)01QYX"1WOqoZ;+?:;O)\&hB^")$)pub#t0rAFIuf PMqZ2^,`OeRIWWukcF!HlBj#54<b%%*!bYHo*JPcSm7r4XjXSW0.B?oQ\@[user]TQc7X4D[/user] (Uol31&'s$>RQ9(Ds?bTN6cdA(!Ldp9'//U4INWaL:V[HoXPTU7a^cth55&@[user]FR[/user]*6/ -Y3r+h-c:^RBt8W[:e/CR`6&LReC1t11)HQN/$)7^GSa=7P*1=:e(hXWpNZ(r@rIf ";OM._Ar@=+Elmd>O;ukFBLJ^f\LcE(%m"h[:"\)adq%,me*!=CFQB2Fm&a>DWanN [H-G?H^=I'NB>blopr^)Tq,EO0#C=1jh+iDU$>UR[R33V\0Q#.Fee[TX\LR[bD[ja T7SIM1>Y!#o?iLKK6=Ln8U6Zho.PV#B`YMQ"iY^7ek%ScHUuV<(k5n9Xg/Ufi`k7^ 1aC#KMP_!(\>/hX]W[DMP%M_L!8m[NVtMi$('O9N[ILiH)9,/XitG#c(]"PLooUX9 &7_3l+o<6gm%e1$>YfKHpO;k_G_.t\QYFZ"nB2HiVU`*+pF:o/NOh3i1T`V[>_@SJ U%j_2T70Z[@=X.+^Jc1&O^tZ`$Yd<6kZ+8(FqQ%\&.+a#!W*&DG9uoS%,?J4\E'e< #2NPB@O')c4q\'i+uoh&$Md6a@MRpTE(5O?1cBABefr#C,^cCSpm>3&kU<djbbe%o =Y8e+=c7dfIpbY%R`X_4n8#8QVIqpSE_=TXQDZ%[,#5[JXqVKk8-i;'G-8=i49!4e aQV!'@[user]u[/user]"t%iTf'<c7ds]036@_@*@=+mh/Q&E?]P@c_>F,O<FK)42M85oV'DuV2Pcu >mP/V>19P?e9$kK..Y0cjFFAYqFKR5-i=a/JkPQ(A,!39^g][^ZuOHo6H2k)p[n8Z CNQr,7V0i`=I575T)fkq%.0lLgFA+qODN<P*oE%J9n?/G[r/_PN!#Aup!lN4Xb3Z5 Z^Msbd/g;DEj_87rXu^LD*Rekr3uK1hG;NB&]@[user]3[/user]d@4ph\#H3_L$dOuf6K2E.kc8Bh %>emBR=i=!TY`(;>mrq3SJ3,*I!jr-Q2V(.d!L"h"p$L'.\NrRA/:8.!>2h\8<@[user]hS[/user] IE2\(.6o@cc?qk[%Hs-(P(<3e"XS`sE8(eoogf-+1IC4;EiU%j6HUINNqn>RI,ki% [+6*U8o<-Z(:0@SZ=&'4Imidl_""$V?mXHW,[e$P2O[`\s!T[]3E=$*'d=>;JLaiq f&MC@^(J>Xms6gLQoO[H^MfKFiprm;%_)@[user]H_iq[/user])Y@gg\c_6,23Ji)%>Amp\9:0ZQ- U:8_LeQ._Mg=-t0Er4dYZ'W>Ej5Tf'\70@4*-PUTXEMAR!09WZb!KPe5ciE">AO*N _fE\Q7')EtXHG"eA]tr(@[user]auFGMHFS[/user])=j^]a+Yf6Y@LC+$pS?==]_:";]tA;;W6'K6 V*?UAaoM$FUbiNqj]6bM@.`$P)i&q(J7Ti78ZB^lX0]#K+/pj!PZ/9!8kW<[e.[^t mL']FfUd:DN*%Q8LRIhS<4^(K)slT5>s"q4<Fbrq4iL*MgV)j?MpbTtjQ(0"S[MPL %r:BN]n"O2WMr8LC2,]9b57tP6?SkJaOedV&;d6`1quS[eg7YH1T=6k!Ds&UUKpr, O0WoP8-+4u%`PV!%"oX[9AY$6Q$D\NX*<pFFmm_e]6>%#IEoOBoA#i,ML5Bn2YX4b jE'$cD8q2d,55uf3^pS<J9#Q;(EoDl01*C-G-BI1Jl<&5"+=PoOho<i`)<smUt.`X :B7,F#$u"EjXOTI[HTHSJ3'J8#\o(M?I!8aCoQc_>i[9UeQDtKl1CErGMFA:A3=mS 9N(ZE+lqj\rc&FhK*=7$,u$(`!SS>g%,#\19BShC9+6Mm(9M(4L*+Zt2L"\_QUL`3 D$6--')W<uZLJ2E3:[d.(GA)O9*A861r89)+SDhQ&'7_ZH"s76jM6[!UR79Yjg"Cl c<I(dM(2H1Uaj@%&XVT@DjN<m24E)/XBQk\kHX[TT\mP(0q5!#kn[#[<KZ<R.9>'! QF6Js8FiSp/3!YcnEXDLH_\517ld6pZPid%'D@WE2%5B(o)DpTs.R-]K;(EQ0OA6j :-&\nVE'M$l@QPq"LRls12=1Q2ag)#Pa)t@e4*8d_X=_rrP!X(m]sGU.lRJp&/;Z) L^G^-Gb^6f0sO;E'@[user]Sl[/user](F=*PRkJJ>re+Yq:5qld.9`+:H1M>#-I_Y&oT'(*2Z5h1G ^uM$.4H;PuUhTZP\d@$NX=,ieF-EfJh;nGqNk*7JA9dn3aG;dY^g`jehCO5s>+,KK >4n-aH`P_*<5QgNL<jLYckka1&]_EeYU4uu>Sm422ss:sNpfNK51J9A&$fJ$ngTuC Q,B2X3@+%R;[:H@*C"K+dN,/KUq`_5i[naD#rduP$Mf7$NbqO'Nd[HYhP<`8fD86J G=a<daZ@#"lC`q!m6tk\T,9*:rSGr8jEQ^#[>@[user]46hE3-[/user]"#4o-@!S=1IEJn`Uq)toU PqRl3Pr^C7q!,iWX%=msNTjpM]RS2!csM(#.UQ)aE<!35=*-i_3ZI7C>GDek)fKOu ]QjG6[mDnf/M(o4$VE3\5(:a^*&tSlUIel]o2X!Srp#h68F54N,DqE8gaTgXV5F]J `:=/^aCL2K&<VN6m&>E:r:KM[K3q\F&(1,ch/7W6\VXil<t<;'5*q\$]?\(FXA'4B Hi$KTaZ3"HXcD\E/l>^7p7cV^Ik[1@6X4(Wj>-Og,8^dZD*Qq/btP$[R\2(JndM$6 nM:QaN_dA.TA1JI(4ai+QEoKK[qN@:7S\>O4IfmpL=;f(:O\eD6S=6e=L'3X#F%1] ]`pZ)==/$6q,K@J7GtKV"--QYC*o=/5%O)FoNO*+=5]DfMHE^mO%s,RcrU9G7-7/& U<(B#Vt1ku$U(C2MPT2Z1AWb(PPn(>[VSYRDqfO\BlL<:64]#-);W>oA+='V7</?8 8%W+F`k4oA<kDA9oOlueKtr1l(1BnCn:07L(F[u:!_bs=n6[]tLjlH@<`.,aRd?=b HEI+L8Ze0@eE+iA*1scBjX<)3/(XPr?;9IjVTZBb^.PSQIl3?dXX_)"/>Hu\-P\5$ HF;ao<i4'gat)THR7BuZ8p`jhUaiDreYP:?A$:2s(Qm:S]k:^$Nchs%HOk%@[user]pM`Re[/user] BogI'nTY<EjeNm56hSQ<qs"jGD%VU[f)I)/k$7Rej!V;sd8,/?*`m)FAr64`5oqai 6kSM.m'W8V>"qA'XTQd''Q9E;*U]Z\M%uR%]<P7("aaa*Ht+_./nPoG`lUTZTJh%k N$\JgfVLL3)1cL+7<[cXEcV4pK%tLGm1q9apUBI79?okIT0QT-?,LY,_9D;bnBu#G J2]-lp-8W7U\+!T?L@/_1N\B5,N&HD_KS0qiFV(Jq:`X#]D8m"@[user]D][/user]":A]jfB=i,M? iSA_q;\>VD'(12miLdB.03s5;If[g38[9ltf?6AZ,cQG\KAMj1&jDM?g6gX!*Okup @[user]FtQr7m[/user];eY"?D]>Ea_$>)iI]_O3Xg3lsA:!Zh_ghkVbH*lV_P(P'CbO7oJ5Pk=*,s SV9jE9BqIm8_C^?^1ZW:b?Z-@[user]_Vfns5U0e[/user]/j7O:u26mZH/0\ub5<nhHG;.@/46p0@ j*<:c^C+X5Qm`rBM]S=%Y^@[user]o[/user]>\8*Rcap,^B)i/lf)j"MJfJUJL3ktre]E^+fn'*V4 ,Ss<'/p_<nT]l'hhI)6_10l2?oJNg0)c$t[HXM0M3hf'6L%uSa*,;EeIQC+=fS9nV j3_HZD%fIBfg^e)2FYo['*N+i/-"#:=]1hG\T*5sr()1s=$h,&S^%UWZjaS$h#pZ7 H7'bY6ING2I5=p#erY?7m(g5nX\L4gZ.9V-<.c;pTB_0(eS&`kqIi*QJfN.5$9g6e a6,=S46.,Ra+j+:ieK.<&2$#]8l;s'oZ(!=66]KQe=M(ndCBKNk9L3Zpe=Yhk`k#" ZP/3k/M9)\K`c/=R1?d^L+36V,GimeFj4)`pZZG44`b]eDma\@"H1V,Lsd];7i=uS [S3/1`hp)aF&l9QPb"QDiUaN2=r@7CV%n#&m>e=td*hF9oQ="t09"-pdU]oUDYF^G +:+TF\6T.<+rJG^gZA&!7;/$[@[user]Kr4[/user]/#0A-hX9Y;I)HM<e]\UZR)->B+.hV^;&0aZb cc+h.)1TiLdJJ`]H&gQO*J!@[user]UegL\OD[/user]:*V97rR,gR4HfL>O!["U3E0*$DM_fNo%2# >460JLMTa/H6;7CpH9M0`><$mli8&JM_AH*`&bs[,Ur)b3VajM@;"+jJ8e=dXX0Dn &qJ?R>iDeoLRHBrZVOB_Be)>N@`>\':c\*3-OH9uB&g5",)h^=/omf/1<*6tT#PG@ o;TLjlW4BUq0(I.dUN%)F5BWEU:A<cMDJt=gkD+1h5&\d#"^Di.05FfU]ufZ=3Z^[ )38ef`M")>9!>!=JV4c"eg?MJ1hGf^2;C"(s1m1583?-m$^*uojO&8_p$d<+g#<2[ iOuYfD\-;6L.nF5$:QG3:qjfDZD`I0-g_PR=RWPQS;+`\\\UNXb)Mg4Sgu_ZHK.#9 Xb&cH]eM$UZ5QJlJOnU+0Xij!C,gH+O8d@@[user]6[/user]%&RanEkG/IisD<oIUrG[@[user]W[/user]<ECa=o! dJFdf7&!DaoY&JTQ_hD`&;fggOWPcEI=;bIM%3.VF<Z$A(@[user]859]N[/user].$6<skUAh-(*J J9eQ,kd["@[user]Gc[/user]P@*Z=oqp2@NE!"KaUZ2M&fdm4Oe`U5;E3>E^*[=M1=$Rh25>*)fe) iA`kAql;.;.UMstg-?U1*fll;%r&H\HeR:67*ae6/IALG=l;2&2`4f'_En_1-OU`k dmU:da`',cI0#lSA"?Y.\9\.XK)c_ELZ03l'[@[user]YD[/user]"$0F0Za9QoYI>`e?sBlCe$>l4 S1b%8\b0H"0sc>uo",u3kpLmQ)UWABf^4oU&F\M$Gd@Bg^Q>G'+,.S^bY*<eV)50* H%?\iN$g[t?$P?9XJ6!hBP0Nj$C&ThlKZF?FX3oKN7F`"9?i_c9$$YO4>!["GXN\% <t9p\BF4.'-9oHs<4Oe8Dn%<s;JWCsBNAnJR=%L?niM,f6.K_r_#e%G^7o_j7?geT F=0F.W25q^5'$t*P#oW()PX]N20?8#$]u+9#"8J85kKL`cTFPd!,mL+,7puO%8BeX &?Wu@Za3Y1@mhC?U;Qj,&qXHNp0^J3`&;D^;WniQo2EB>DPW6.]LbN;*%.3RjC=$I q#<^-ff2E?hJq?7OP;,09[g.%HZlBV./6]>FaPD@U^;XN"@[user]6[/user]?^&/8)M"9dfhN^N5_ DkGk!(Z=42#foY("OW0[Gf]F#q1:1:c&529o%$j>C!oRccZtmlT03Yh)CMuBIpcpP oD:`/(Ct\MU(R+%.<e%7VMAb1:]7Y+H5(3i3;"gk5=mZh@rZqO65*05Z:Frb7P?5Y T.F7+)n(')`Nm4Mo<_tlQ7.HE[FAKeS=YW21g8ZLMrB*S#r'2W5N*074V!%o";7b, oIPnk&"^(_^HT&]RTVn0?Keg'eLZWgNIYIHirnE'o3C:es4J^pTC3CA]G>_2$qnHH ,K%FqiiZT0E*OPlb?u_.(Wq,c!)a/G-psp\K[BbZh2*rDrtV-="Qcikc_h+,_LH@m h`<-m*,E<iBr3MfD$Gsu)u,^B]&_tEI5+2k9^dmeA-I]ZM\l:kOY9l_a+<[UgF04j H-*$0*CD7JR\IlL/1bj8C9VrBcffT0r3(C\C<h6:$diur/Q?VA8gDgVbN3[tTk/=2 9/c%\Z)9R?!B9HZ'&Ek;a9ka=7<!3#ZW4V1F!>Bkk<!PZeX]YEeII=J3uDJ=X1G;p ;qGe>87'1IW<1$)31FPQC_^FVU<8%1g,Sj?PU)n.[c#9.r5\SGjOJd)_KSSgS3&sH j$^-]rV0>S!?@[user]mCkSU`[/user]*0N*7*qloJ#%\q<mJ.]&Wk&]1Hl3l,Qe0icKKu_[:YpgYt ahS_W#10"l;e"i9<(`sK9uSN#f5(k&<C4QJU+\\fR]PATS,"p&rB;bo>T^qITr&q4 I:s&gQ4$PD7'o^X$@[user]R\R1pk[/user]k@"/DMqpDA>K#59jfpj&T6f!h/VnSdmtPm3tc2N+U] XB'BO8+Nk]JFB>CYsP52ZD9CV24gu8;V@=F>5*];9&kE32WN(Gp0^I.6?m$Jdb(03 h*WI&FE/nW"s/1sl5j$p31f;U#f&PS6Yr[,p;<6"'NCm;5$!/6_I#4/Qa`;]R9R(O 8ef=6(j*>Ai!2OXH39;n&ob"H?X&kd&j7L`kkPXiV[<`4h4R.6,(2\61!lDDY5j_? kl>-h]!HRf!^3?=>N.RkaC*EIgc'&'l&um3%7T[7B1F^S>_pL_L._OOJ&cG+$&FV> _A,G$qMq"[lj.:S4T\@[user]9-Mn[/user]?^2anZ8!\R9A-bIr=+DRp_flD])N%?0[lq9_pRQbOO C-5C[nj-Hsl+2d!^%0A=/c$E7iVj*';SjE?0CFeb$/W*P5('7Qn]&*!dKmr"9W$`: G7&Oe`08A,);?BHCgni]A)?,<^s_Ym=LBtMQ$?M4:nt=Y]SuHfSeElfc8oEN6dPMc P=>6IOH#.aCfL6KW2uOJKM(!#,ZHLOb*RhR!GSE(FW?)Y=@,"D.?KOmh^lQhHPW\. IHIkEV83n!P(o"^Bil3c]#d&Kh[uuofR3Jq$B4WZX;V,*a^?kB8H+T5c\0i%jRcqa CHoesR,/6QHL\niDCEZZje1;2LB_I'-<4"h(X!PYh3>C-?`.i5liq6(T<K9[PR+mp `DCCaG!e]fbV%_Len%Aq\YsO`2_9%#iE)n`qHh[9<X21ZcNbW$jj$b.oeY*p5mV$C KHpqT#"TL`Zs.G%'5kAZK(+!-:%EeUD9OT@H\e=bDG3(,1.I9MH(Y++D?.G?3#E@B -[J9nDs[8$bC)\WY4C8NddPFrO+_Yc>,^u[k@gt#g[Kp.8hRW2W;p)$:ltT\dJ.C, 4[]pLYVXFaFFC5l@'lN_L``(7OdU0+=('2_8sHZHd,?!qcX7>/\&nncdL8&Y0ah=m A@YT,$/J5T?R>W&p23ci4/_$o:WY-1%EIZ;VVrrZE&-@/IO),sKJP+KY6_Mmj'Uiu <3h2%Q:%"D%*'!ncWq'MA&dl@PfDD9OsTQbBO!Utn+cS.hU(Xe$)*K6H`iD=fLJNC MN>Q2J/ftf]D0Xa(t:a&Skt3H:Zu,R`u'/'V\Kq2[A+;`'fMKW%CZXO<HP(_UrA!* KH,8_1&N?&BhOD7$+Wh'cZ4JSor*Rbkng$N\jokt63.bRD6j:$4"8<>(/CC\g.bSU f./F9TLFnVIrlkm<"+1^1r*A'bmJl>KNo8#fajf'L%''$EpYL0d8[Wk):PBqSBtaA eop>k\?4Ln]]B%!aPRocJ"Oc,5L_/tdAs;n9$Kg5H?BV0`=o1L+9]@,Lq;lnWJu01 "oMa"77go9XBbS(Fa/C`='3E/P[3g>U_.6XB.qB!SIEG&5lMjc!iuB8h'OapRlJR[ 0YLlRc?s0^O0jLq$_+0?C2VK1-o:Do1@]k(C2f(tWC>?P8I6(C+VFfNKSZ7!`\4\. Q0DS4B@.=b.15t`:C)&%fN?Ij2@=OU&02*.^0Q][#bo4*H3NHE.s6o)$f(r5Tb+(B =fI6U*D(nT7q1f7+5GJVl.a"!4ndi;cIh=I'WnDEmiU^IhUa7DJik8`N[Zgo:jGQF d2nk-'l\K;Fof"G%TN'@[user]o_[/user]/bD7ogmHF^MuTXCN)V&,NUuiq)nAk,3c(__HenSC!F" gKJeuj%u>AgrhNWU-TW-/cm,Rn!8XIm#Qtg:NTocFS1do`+0QgFB]e&,+a1Anqr8k :2^r>PFIa=Vb_4.gsYmIVa#jc<&7a$d^p9sWAYbT=nlM;XoM'`"ep+bqsDU<p&Oi6 2@s7Cg8&6O(n*](3lIL6n0MQ0[[7LMjAljW[uA@EK;EnG]8O6-Kb9'.f8N),7i2W; +dr?)&Bg20(SXQ=Q3rUQN>aIS_\Zi;21(VbF``Ra3.Eor6/?Wip[f:,6_F*)dFu_` rAXP=q3C.\[d%,C65U.Y%RoX.^CgOqRDp+peHiC.#2hVqG.^&Eo=]si"2":#-B3u< 4*sMII+!tJ<44_b4?9&)g)X\9mbKIp<u?sda_7`[B%VLNE(8H1*fQ(;)U=78T6mEN &;JL'QI89"K.N_&E`_nqg</^dOm/K"7:/;7;G,J>OL5h$%B[d2`T]/6Z2>&hr_7XJ 3(7t]@[user]9hPifsFM[/user]<8THBK2?tKC!uf\-#ne2nH3mK74,AK?+tQgWNkb^Cp3OG9BA)Bq 8!&W[`Yt+(Lq#!*.[i)U3"q3nlu]U+e!WlkrNM($o_m&:C7L_Qs1nHepO/Xjo9?!k ;k^9pWCrt<"d:ZIcL$sgC/i$Tid"*gYHb7\[B7G\,0N%FA.>@[user]d5tL[/user])UVA3<pT67GW EEQf<^PkMhIC6EHe!c,Fg^LD[?EodM0%]C=%#`q@TU(*k#I]rG#Ft;S$;B!&>4<&5 8V^L5A'J9!T0t?s/sT`SQc'8C6nJiW/i>;^AQqnt/k[^Wo%^,uG7_s>GLYTq8VQXa >N?ZEqgGTs?tD!b9B\Kf[9PcO[(.OIb&&>g)GXnDA1MdL.=PhD<g*rmaYMtCa*&u% HVX=9a&QE*gHSG6o45J)RZ&9aGYd[WYfNMj1Ui*/-KqX6D-F^Ch2U`<r/J_"@?5`e GZ.XgKrjm;^81hVT[oZ#fW>;'+S<lpUF$rj'H2$=%NO^'-nT8PmnkPD,#V^Xq>-FK Pu$u4IP7m$WAI5pFel<n^o/?c%eVU/WI)I(%QNSf+Rpu7R45_mfRW>+;Lq\irKQQ* ho;jUVGg]kDp_WW1%jJhM49i,S6>?CA)`>P+H21!gV)4TW9IOHKMc&8S16p!<.Z+a 6l8A\#oI5t0P[P8T^EjGeqR.%)clPoKMcl,?rZ6oN7o'39,NAL<T2KQf)\c116=l! eLhkC)*'7rC?PU@=fQ]L7<k6Ll2i,1iMd9!11+S>kTYr_Q<48!Qa!E_K!8qMG;+Om PRK+ck@;gbSL.q>WlQA$5^X\_;%mBciVl&p6ii4cJOQ>e79>".#%1:d.27[k6H=dh %?g09AAekj";[j-4P"seMX;UGl7LS`6Lhru1IX>I=J4CMMgQ>E_R4*XatW#<gfI%L @[user]W[/user];\IZ;+4t8KJ;V1r!;TQg6ns$BSaA36k1gdK#:n7eXn]VN]*b**N:F=T8N*J+GJ? WGg!9=34EF,>s.7.+?uJ5C2aV75q07-(PS%J.O)Jb9CqhJN0;`F)6&095eU\Ak@.) [6-GmW\,EEW,C\Sc!*PnWq5pjs/bK@6$6GqXM1Z!$Aj__DRCn)MaV`K@>Dj]KBu'a lo'C\(o/md;4-c!ITKJhr9e`)SXQM&D*`;;o6"iWKBceCM><``LeBT`/DF#Ke0M]u o'+^.?!S.Gh1E.;4a:^>MrR]r1XD'H<IBjr$GE]]7o3=G^?`UBI!OO39acZl>"C-% P0Yn5i&m&!b)Q#Ch`I<re<NXa[-U2d2HcW?@[user]][/user];qCS]7%S7k&6tMGtCi&m%:Vfl0N! $HOhA7eid!V"&Kc"#?=^4@L6Va:%E*iTG$`Tg<PC8?7s`)3M+#E0J9',c$s'bm6LV Yd>NSS!!%$gqkq<9VsI)nU"G,]JMdm(et<<[Mo>[8B0Mue4/$q9gOrHc5(ZeI.K1X EqX\$\+8fb`7;DuAe!<8F/Ho&Z*L+KAnk`"Y\cF8FLP^m$G5>8[3f$l9=hB/<b883 "XQ50)rgE05)%>Be#S\D'HPcEIV)]);gX;u]:h2B:_2$<5]N?RYjDc'MqT7b$buB1 [>@[user]Hnh\V[/user];OBdeduORG)G7c`0'a9'OEiY*3N--+sX5#-"l&BK]*\t%f4VgWL\q:<lb ,#5O[^QmP.7^ZO)?WjWmF$qpIk2(^h7CkpD[PU]\hWJOZ2-qUX50ltbqA5NgUValI O-4PR)c$/3U63jE6,b6^<%uis7F5ARgdAa*\_I,b&&^[)d%6[^9\%L]Gg`0G8H4WZ P:\d&mA["+OAl?N.RJSh.&dK;F2t5ap^86R8!5+W"qkb(#!X-$nTXT\O>)Q$pW2N) eOuV]+CXmo,`G8b(j8R@;Sk+T_C5F?,`D^Jas%-Z9+j]`VC*XJlF)PI$);Mq@@[user]U[/user]=, .M[[6m!R]EKV;@[user][8\ul[/user]'#pWt(@[user]2suSEK2[/user]<'duZ8b3iV$J=n@8E4sg2CWPRhor3S"! +3j;JXO0V]QEj*b^aW8c3?AZlT@HLBekZ\jjnLET\>/;nlZ>jM_D+N;2\o6FcFera <.pWFe6.=M$j]G2%2hu=9+?_(><^0/cKVpDl-oU[I(`cLpR6/QIT6d_MF>F:SK4QT Mom$\+S1B*TLG-_-PC/s^L*&(p9K-%nU/Xlf+CukWQ,D<`Pdu($Q`qGC-@[user]J\R[/user]+8L5 +%F#Wepm#rr?(B4c,k2D=2E)LMRuYQD1^ir[$3ZaLcSBYB%rh+FnO\>^>K*5:gRV. Y$W%bV=>A=6V:H\"=He(+Usqe_?]fhJk+dg1)JF5kGa4*)`b"R:k2ff<KLHe:.2NH SRcEI^$I%*Nkp*eeVl"?[pB-3N$cr'n!JjmgDtDh#>At5c-:nql9Z9$XTZN=mepNH @@?$&f/,b.ZN22qP\$h[0o.Q!8^C'T4gW10h_3]`9siHeL&mYQZ.6LG3%g'^iV\hF micfVH:LSQXpKDkLSCoKAUkXMld=Mh>:W;WD/JTQ8sj&_%=">.gr2?'KA\<f.Q`rf X_k7-ZuCqgPd7==PO^h9q[@[user]L[/user]&i3t#g,uk9%FE)SLqe^C9gT!K=L,CHGR541ET&I6' P)a!EE\3hd<R<L"/oBk(Q$'Wt'PEc.a94N;:OO!AZo]rkG(9:3gs)7f!u!M?/0(Mq l(Q+9raYO(<qn6`ejaP8as`1pk9UF@f>+X0V`?h"U\b6e3tOSb1s-m0GQh/Y^>"?# l1IQBoB*Ru<"d=V,7)haU^KEQo=&%Alkf&S[5j1RUqX#RN'IV<UkgBf+;^$1P$uid /G<*NDofTC**Ti.A+U@mho+tbJH[lBn5V71q%1Id_5:DAb"ktJnQT3&M"k*srkbGH +TDCq@IF.Z69u[?I_J*qK`9#Q.)4O(G_GQWi2IZNYPIWJ(pQ#A/F)ggUZ7R1h,Wdm mTm;1c1EqOr\aD(F(fARBrI58m17b?`R:b!L+bgE6O=72FY897MAb7k(`a802?r1^ )k<Q)+2!;"'KpJF1k'(S0Ub3E`7mR;Kc@#W'.n7!-oX0cWC9jfe-8H,?7Oo`N0e<R >@[user]eYlLTI[/user]",(bsJUa!%$D-_%mU>J)5nk`uJ\F=<Jq)1igcL>uTk[_Q&R]g:!/L"csr dT3Lk@rW.%(kXOS)(<G%REjVQWCr1I2gpU&'7C@50fY/A3?M#AL\(G9bQ%<dN8Cuh CMQo5L$olV3.B`,a"IbR@Y>[mj"8m^<2\NW11gKY%Zop\+Oc66VO=\\1DrHT(G5fW O^YU8&Ub`j`0C_k778\?2NNd#:Fk:<kNPq:n+>k$,m#?)X+5Qs+8+cb#\A==("s+& RV!"i]m@X)p*)OI+t5&er$.Sd+>9%(Qh"a%D6ZD!>l3Q2@qgMk=7iB(Ls%`DRfM;N D``]DA*W=454;"SA)`iMOk69>9dJC/UHP9$ciS]FEi/_"YGPDQ0TL@KD7]u1:P`LD AZN"6_fE!>Cukas>$QJdLr/a'HMZ=H_S_sJpk?PRn-f.>3D(l(HLP-uXbpho;/>+l D6!lVGU7%fi7t@faf3[kcR+&5kmWYKT_msDH>%C4a88%sOt4kp;psR'84:uEjnZG1 M.VoZM:'2J.KEP)AaJtoX''V/`Tp[*_KJ<&"'%a9K$Z^W*j5`Q*Mr)X3l,JU+'/Cs MLOD1b/#K^P$CB5To%O!_WJSqf-(KYB^[JST6>W_gSS@^<GEP]D(E@1f]DW.kH0Iq lg^qjU`Qml,.^+3;)[OC0I9H(]sh4$bQA&?C/\<84HJ>m<HbB()4Y:O3*f"C6f_q\ cnl/KH-bl=(=FSi`#5!5M3I1^MjGdR6&rV>-_[Mn>_./hN^8cE3=8LJ#<;d:%daK] G,M%o;fHSu3RWo7g17=cjC(%Mf^kZsCtDbLLa?Z?[pfjN#!&^b3V<(OJX:geAPOoW P'SmE[RI"YfF]iZQf$"=0V.ni#u'Ntf37Ae*!\X!AsHm/NLN*.:pjO]@>I.)2]N2S 1+6puLF?-1Es@aHV_n%g/GUm6d\`'(Me8Z&oMeO,O@G_EZ\]Q9)/L0kNm"`ooS%=k HXe#L=0J:=Fn\),O?"pg83\Y#T$"W,5;b@>?j2Z:1;TP)@[user]KCr806[/user]$_+]H'QV8iVR, *>*C+ko+2$mc/!/^"3elRWTtlG*OYhG\C42Tc'dh-$RH-ADNZM'sak"mHPb+:#2Xa (!6r\^QbLOX&R-FJ&4dCNE8[rAK[BBXlP"SKZ61)^i5^U=bP%lPO3ha[o-2gBfn\P f"9dQJhD<G*;tn(CNWEun7YQTVkOVGNBNMfc[Hj-,,;EnYH+kEkpj!i#*3::YsMlc L]s?p;8+4$Q"`+hFW\].A.>'V>M6:PhEiC"7m^(X:A:@>N-'7CV(m\3@8oF<F=Oil 81@5*W"bL3KlKLg&/$ZqMYi"6eDjMg)elP.M'aM$.O@f:W?ZIYpR*>fch6b\KjR_f m<*8WY^uN7AsnbHO]=sjcQ%s8NGA/P^:5@7X/)K)b3:n=dsZRDHcqg1FB>tfcqP.` P7e,V,Z-WPpH%;lDNMqFnDXY/g-l1V)r**@[user]`L55c\[/user]<Ks4>jCt0de*0p-ub0,O&$>I o_G'<][$SXl_ub&1^@[user]i[/user])S3(d&#<[<Fh&ZOQ'Mg98TK`V\kq5\>~> endstream endobj 45 0 obj << /Filter [ /ASCII85Decode /FlateDecode ] /Length 452 >> stream 8;VBdrdT4\hu/N6rr;D!@'jDD!u;(T^]q_$W'Und%#bTo":%nKQl/6CRpn3hG-it` lu6?HN*X]IbfIT<U#<l)!OA8!3@mj`A!,dS/fP*$#L8&-Scqko_Mi7I=;ccpD6+GY jLG@0(o7?P(g0rX'+-!R;gK>)+7h0H1,3aj^8O08_njM.OJBVL^s0*VKr[[MMP2Pf 6+MrRJW#)q6%f@&o)kma";lM%p'ER[2DQuQA7uNNpgM=\+97_i?tbk?`PC7gX.N<o VNEIGJjZ8EPGZEV'rh=Yh3181)Rf5t`<e7Qb[Oul=jIE`,Ub@5A#SA:@+.6"c?eEb <(>16-\i"9aU9J3MA[7H)Ou>oftaS[^rXHin:6-o?i^YY_*b[B:1LMi<8X/f_8H@r ?Ut/sK7"@[user]UJVJ`[/user]!^aL$'UL4dpJjBS\#20*Q?keP$=oa'Q!s!OS9$I~> endstream endobj 46 0 obj << /Type /FontDescriptor /Ascent 752 /CapHeight 737 /Descent -271 /Flags 6 /FontBBox [ -45 -255 1000 858 ] /FontName /BAFIBI+YMjO13 /ItalicAngle 0 /StemV 58 /XHeight 553 /CIDSet 45 0 R /FontFile3 44 0 R >> endobj 47 0 obj << /Filter [ /ASCII85Decode /FlateDecode ] /Length 260 >> stream 8;Z\p0a[t:&4QV0ZOdn1-nC+56,^pc)l0_-!$8q.=N%=(L>KkD3Kr[4i&62K4Hbg( ao%R&g9)K`diJ]%@[user]0E34m9[/user]&S%7$?OlK"W,A"\X%;IEfoD4uonpa#hF)9H;p^U4i*9 8OA9)97AY)2WtFs%&l17]3:6tMcmgb%*/1Z[Xs0g)GaVT@?]%Be:*g]imhRha*u8U .JLX64A2C#^EF[Ik3`jK&KJ'>V)4GQ*-PcW`tUs>'Lbk57JVe,!!<57jq/U~> endstream endobj 48 0 obj << /Subtype /CIDFontType0C /Filter [ /ASCII85Decode /FlateDecode ] /Length 14556 >> stream 8;Slr#uFT6&q7a2H.T]S0Yi<LY/ee+%Atmf_K\Jb.it'#?AKCoY$)49ZAPlL1('&] eW#HOA51:AdAToAAE0qqef'0"$:_ZPM<HE6XJXm]LWVeYgOF?Gs'8uUFar5L+\4ga UX9oJ$m/b/EF`Nurku1f5t@/UOf]\]4ra70Y#Tdjf!7AbA=('$A<`kb(i*.Z+&2NE 1lUqLP)B'.k>dLG>.L:_NDN&2YQRH5L]G:_";4!g0OZ/AKLA3@;+*5Q6c9TD6k\H( ;Me(V#Vhhtf*#k51a=hqOa6"AEY;MMXsG%/&'=3L'7#*j68k%ZakPl^?)=\qG>Hg\ &X8l-;!Cq.[=i:mqPXEUJ53!uBK,lJ]pc+#S*8o)$2S$$"o9EkNIFD_VL*!E<Yu95 18.AoZ\dAWI*N^DN\RH"%L/?Y=;r3u`j-(4JPBV*ZOQ7e[Y6l^IaA#/[^2Ok1DW!2 1N9$m,T"]OF"T)3H]&i\NT8$"7GN9nR]GK"E)#+"Y*HW=h9`(bVs"N]V>A1-jn]_g HMmmC#sO"QkFHuA?c"JY5N-hXHh_4P,(GlmcTg@"H*9MP0H2PIRit8%d\k5?@[user][B[/user]+k _N3%UBg`9T5^YtA&[+(fR\Q<!ITet:hcRYLIa>EAg>UbBg9oWZ>+\Dk%9Z2I<728= kK"-=Yc^CgRI7i>E,%CUT,pVnV7Y:O$^j'<*$_dMloMS-F)k:9=ftutdX1Wbr)EXq J()1ML)Q?s/dWuD]>=d2]^XG.k5SN_RfO*%Sq*"oX`8r4S+5[Wi4oYMWrp*H,(hcY 7g@QJ589H?k<dB9CI0Y/\j@?'+.EU3-c,r%b/97/:$0FWG0:hjbLULqhea:d7b\T' M7luZ/0,$5_CNLX,G^,a&JlX$,1f80UXhj+6naJdMHLM>)Jb1X0?t?B.B_Q*mHBE\ Lqf0NQ1-'HS[^TJC!rrUZD=[e6^.6l5BCEsl^aqO*%>)j\^Z\g;UZ,QkG@(\-kpX/ J/@,b-Aum%/q\DQR_a:]'#!53VbpqE%Wl0Z)<^^&;ObQfLqO..74=-#kEoS&3n9/V 6^W[11KkT(Jcjj&DX(-gF%CnnAc[6dCV&/ZYpeG&)cs1HoU"93X-Q^dY<Q9&qKPr^ ma(S]TC2[9+/`*!/@f$]Z\VclY7LO8A>;opS&.Fk#ceR\)ol>P&n^/RXEf[U."F%u ^]cT=1koE+1^o=_'L<l&6I':!p@b%D,Nbr$:'/B`.bgM9_q`E1<RjcCq<ZgE9-RpC %ar2sq5.CHK"h]#kec+[2($CS#7Yh!F0MFko&/_r4K3=Jaira"1o?`r,'msN\67\L p!M:7f&J?;^B!f/l!hhgb931+3V#NC&j']3):<7brorZsp6\,bhN)+1dq3"K#BoU3 g)@[user]^[/user](iN]6Ff]4K@;If5=(R2"/C+Dpr(0G&1rJ*>5fdE=sI<9YmA7f@>d=_p$_E7-D 2bJ^E6o9E(23;3sAFSmeZQt4IBB=1Y&AE!Pa<l5LN%?g"N</igY=-G.UDO91)BKlP S2LYb!9,U!Tk6d0Bl\ZUM!JV"W1&#Fp\<md*aab!^d<</S.fnG4=@[user]NR[/user])LY@[op=o( iK^^f-/s,@[user]]ahq[/user].C`TJ+!CpFN!ZaCuDIA#*.;0K:#6gf??RN31UOa5j!&:QlqX0RE >2/<`0op()G,!ZASHJP(K7YMEIY<5'&gfuL3,[m64?F=q%%'ZC3EA%@[user]g5A1QUDlj[/user]< `*%%+XF_(bkObkRooefL=UnRY)QBFR-flOb6!H6$0EO`!#9DG^3&<+8QNVk=h_GGT i%,7:?jNXiC93+#b_-<Op-L&"Ijk\0b"QI\TaXZR_K%^rWF[qa:_"hnJdMed6SKr" =j46_OSfOj;39If*%"4n<[Gg5^@[user]D_aC[/user]>&O5B8/Eenuoc5"80%ZA"h<s.eQ=CriR_$ <Q\Xh6b@ho$+q)L0U/M,%)r9(`MYH;56q?0G0i=Z+$KPHf?fCN9`ckD:Apb/SAm=V (Fs%"%])Ia]R^-nDhANd.2XCYF?U3e5d7O+Nf-_d<li(1=Jd]R#1d0&KW4@)_*Y@m -Ii!C)t%OlUCF%>d"<:o]F-8]@(WW9pnh>1;BfJ*gE+%T46K0&Tp3ejT9S]4op+]& F(SqR^V,q?>P$bA8F"-ChO"gV37!2O16?Lg0<L9t;u!)oo+)jGgD6?[g0\/j`/In` UH$7+mCj"_FV<sg[!;F%*f;O'qKX/:9p4F3m-;aml?a-Ro`Lo'.\S>7dfd2j<f1Qh /%/<,nf=eFI06.-#:MmP//O*Z%<dQ)HnFFZ/`CgR%M>u.FX#>RTeJ/2"A41pK>*UW 0IZP>i.[GKd7U>S2\/EU,&^7I-H-ui4nFQqVq1lQ\^Gotq;,I:hdZ)fQVt!_#SBFO /nA:(J\bFQkm6i#`@[user]WE45Z_-t4Y[\[/user]>l(e57XOD:aj1^_d^V>2:hmEtJ13i0iV0$+W Lck)j7e'Pi^AsjGqX01B@IPSI3*cGf9sm[b(Pf*-+]He74r2Bt$);*C>VM`I[\s#` s6-WZTI?uo*Wa%E1VCOs'Sap=/eI%nW#-O"_Is(/&mA6keQSmtZ%/R$W)XCj!;e>l &iJmI;%XP&2&`R8(Hs$O"C$k(d2GET;3V5GkC,F8A'_WO9`OAD%*[M?kM1.)mr@d( SpRob<^sWc5F;!D]9U$i:C.]1H+ebkWMp?pK/7Z3'biB%+9KU<?p%tM+r/gSB(pn( \sGhW>fFKc"JNR==o*L]Ob*W48#X>F&"imqP0(30r,[5NrgW(hI_5>m>;%CL\q=2M M.?b7FC-eiP9QT\9UoF@'?#O0r;o#I/c*/F\&48e_Il^(1$JY_086kr$K#T&:PCHI :?C<_qlkb?ri=)<=m3>2W90/(Un*&6;XdTgSYoQDa0VCD?9fO$!`qM';^gkoDAImh '6+2(I'.\,"J9J6**.T.j?OIW=P2<2)Php>1,U6C5ru9g^MRnA$D.*=[Wq2l]_Uj` OXm?W8Zn4W"7G8p<,n36WY.,PTFSJ#Zfb%&_IKPE64[JdW4\i"d7ST/WqRr3QF):+ @[user]d-dE2oRll[/user]?=YWs82pOb"hZ/:L]:feanUX&=;-cS<R^ftAF59J7"n6pEJo2`Q>P;o TUuI=V8ogWfRfL'6tQ&$m)8>IeKC-bX.gEl^5HieKYNNA&O?9H$O#'6b[oH0EQTb9 &<MMcPe9rG+Aggj;Yq2fQ^]/'@[user]e8E[/user])V#&t(HO*Tti[B8/:n*j3k[Ga+Ub86dg&2GQ 8FQ+R/0P7FA30e4)UVj1EQD?s!-$<cHm3)V&M0I!Prg/";l=.h?3T1ss&MO9LH\:% >D;X:=>b<fb1QW6"bo**lBiE=_/KNmM0s=&PRY?W?kaV$V(^+s>KX,ui_5.,Jb8,q d<Qh7X.p%<X@Z;4fSId-.cpE#b-iOfXTrKmGbDf)c,d`8X$Y;NkcoNrg-c)k3R2?5 c-Ij'`nE'fQ8^8PluPdfQ9-F;Nk4@3X$9q&a@M1`i\7]oE\DB[LVNQtga.'_K<.e[ (FG>4$pm#UPjn!iL@3+]+5OE=f"D=?m]a(EU@R<$Q*<SsZ"X.7!TBY"CYtL4X])t` BeDVHVJoVLa06qP*D?P#8[@[user]][/user]>(S8H[kXcKVYSjH'MPX+AoWmL1-'0VD0:7/Allg>B #W>op'eEdQ.;*%n@Of;&`]<kA9*EC@X*2$AD(i/2CtPg+IBXXFrQ.J8+U8=+K1**a ITkGTG-F9r)sL0kmq\J"d/0h1.D;L.<.'Ug18<K!b.EQFiZ9^,Pk(cQ61t"%RX6j_ _umq@Dk^&WGY33%P?<2r#-L9WZSK'.q\dpPn6(CJ%5VOs9flubDce-$j*-t,9a`]Q _k0=NZNlY2ho+2qO3t@)[\tl<&)GLQ/9?nBnNXf8m"'52/8HWWLFm89jk>I&V$^;. OeE.YGal)%6Ci26qKB@U/k5"HeS&5$(;,/!82X4J/CN414B-??LfkU&N1NN(3'Lsd 5/^]/]<9[ee925lrVXn&$D\#e&YCVgmaOr8LOS^MRi=b*"cq#_K>g.#jL)gGqe5D/ \BPdI(k&+u4nQGaloFiITan4*T1P_+p@gX'Ft\j%J8pK[s/mX_!hf#<I<@#M63a9o EK:n5''f,9?r9"UT+8m>j1)">\>9CL$*_g%LBXGs7(8T?Yh?hT\g+n4KLnU^1TMV2 hgd+;F]RN#Ka'q0e=9FQN<^:cfB]-(U=M_/Hg"mt/?SEjU4pS/Pg@_05j&H<KOA/\ &hUNFFm?\`4%ja^.X4.5/Legl8h!eM$3tbCb7-a]A)D1kE/@b.ft#C3U@8rfB?8#U f@0+A0WNn7Q4g*(hC+mae1Mq?a0icHi\\@[user]^[/user]=_qsV^9KSr=G]Ol1++8dc;i*QUk_T# Akt72E5-_<Ei&-T"pMO3$aU@qApob/%uO."3/b'*9R?UI`#&JCUZj4pDP65a0[Y-= \b3;8Ys,-+36Z&Kd<XrBK5P9IdYrX.3?3aM8(_A4Oa%S0LWeC=m?g>UDZR=A:$%+' &fa`[JhNG-H!]/M.Q_`*r)Qoor3%HIdFS@'^4SucHc$_=mHEDG<`h`b+VR!Iqa,I^ iM.\3e3IAqUM4;H"4'e9h+i3T'@+fc"k(0g(#CLp-US8oot9RaW-Y>A==1%4jE6+: ?RYDo6L:1:0hCHX3ao]l>Q-%PoD#"6Z9:l\1._7a4o+c^LYbJ\_HskVH:^QF0NXrF =!^gb!J;F;*.,cr$r4-r4:GD'ZmVjjLDfKYL<_m5g!1DlDR>CuaW[.7Q)OH9Xj,rD qg%CdGEH%<7:HILgokmDK)88g0P#]<6kIUP^Y/?[J3iYTK.#tTI792p(;=abWXn%H L/iUf[p;cTR7UFFDRYCXO*EYa84"1I1J"A2;iNlbH`a]#grRP"IUW^d?p(EIStED! dco@N\t_->L7N>1B=J&Xf0f(Tgc=$>jWp]YFG4[RgnokSKt5(A%O86F,:JD**]S_b T-3uS31uY[llUbGgsj:B5u@%o$uSqR>;F>S(jLlcoV-LmrLX+0^`L\;9`C."Us_[a j+68DJHdV6_q)M7cZ[4%_r)*9@4\UGn.'8E,*#IZEQ2i;1WZEM&@[user]o[/user](OYD4&j9]In# -:+CtVKcE^S2"'o12Lf[<[eXt1FR]_+$'I\V.COdMrq2?E9[#VZgoc/m;o$"`5YGs )QF^ig:h'$B#CMU9:?ZfbWVPIl#*+rjjUY4h_j#SZmTq(K%!">Lnpqr,b92rZC"2D 9BcaC!7G9U;2"gV'13<.qeJ.:VcW=@[user]q][/user]#QH^"S+5^90.jg#)AS!.&cjdbU.^L_5R? !!*6k5R!*sLqrRN(??dB?pk/UktFM"Brf[8(sl,b&M5CTLk,'cJKR.N7-"s/.RmY& ,GsXAn(jl([ud"7dq5K+bl5*CS*uko^@[user]Roe[/user]*H<o;@[user]VL5S[/user];$hH!QNRhL*+gRSdm%"5 4rElc_!h6lH`gc<,-D=5aq.X/\>\+sj:TS'/a+MY0L9'[RI4tO]>)jbYg'g+L)uM6 =@".^HGlgK/2^m2k6HeVZWt@*@%UTWIf:<<mU2Au!6`>V8k)Foq>&(`6q5sQ@b%+6 @*;8lE3)XQk/.Z`K/K$I/S8BPRK:iML1t-"crb60YTE,7?GIk6K"rS?$"j2WO%P8F []&8\qXM'3eTg)POTl[YAk$+5<!S!BjjON<n`e7iTEh!C_$9>mdE8kLJ\Xm&#CGe> Ad3&(8f#3Dd&"_r;N3,].$MbGQ9&#6nK=HDB-2\R1.0"T#,E<iH!$lT*M/'XreRp& OeNH0&!8scaW-GeNC[J3,a+7D,bPN.80AoJ'+?cmJ8?"hb!V7k!GP7As-Bn/#n[(> $^X,n@2uit,h!+BX:^$IS)alKEtS%/k7s^%/>/ia]_!q=Z@'ANL7XL2Hhq**pht\u PF1j,L&3"jCkS,u]M+"9L%&@[user]RO33[/user]>!;lqEba@p,A8a#%q-0:Q]!:pnI\Q-k>n9Ks0 L$3AQYH4?:Um"'27f?ZOa-507L"$;qW?=/7$aK:/m?O>";of7=F%(rY69d3;73+YY 83L9ffg*FO#q)eY93/rAU8D':DMMl[_taPK4_e(d\6<f^,WO[P0U$MtJO5[K$8JT* TT1^1mQ7l$rW]eDG)b#b?]X9cdDr$:m8D8FCCBDd`al!cX\MGYaba.Z[nhIfq-%FK ?"rVWZ7hh#E"C(C<5GJk9tn2(g#h1[fUde$-&)U84J^P;T9UUmC-6fTo@!YePen!7 MIgj-5DlC7W3t)Rj]1HojX76):!l?VAelY/oGj+)<*jKZmZ=ka/ar+/FFbuB=Elh# I'iH2jJ@eCRkPX)Uu?:tq/._jn%h_C#_kHp=?P,_B1TgsbXYrtjW/GpQ?S<H_qYcn i)^#69lXG\[H;HE9SQ-"NjW28dkRTNKo9QJQaTjlR<$G&X"*l9p4GF7ZK!\s.7ndg 3JFVao"$&_ok,mMlT,RMN%"+G[@[user]cB[/user]'d(b$hnn_iXRVo`ZbZtU`Qj(8b#_6Zp[?:sH T:kTc`/./^=<Ntr+F&8mR:kHH1Lkm@?G_.#,:%5'`ZJ9PLo[l*d,jN![@[user]9[/user]!5RY6p8 `&3sOboT7CbK"qS[U,)>oTn=CUNd'qDShS-J<i`;l`0C&QH^7W4QMBs@kX]tK'BmV 'OGF.-3')nH=8S7^1`c(cU?=h7ToK*)K3U_%[rm\;-7sMX^)jNRod'B3@csi'9ee\ OKrlBTY,E3h6sAV(tl;TZ?n3-fbW8'd>%#9%ql6J83Ws>;YNQiACb\d)jH+!E^/U9 ,n7AK4ufXR_knt#4OQ@p_j%m/m`D0uI@g$+Z@V;4QEI+V:$$#`1kZ[*C"W`mR?-QM &bRCub<6s)Q$,6/8:0X8:Ht2HpWol1CR4h(XLm/f36nC3$,KbqMkZJp@pH>"G2.8- TADYSjS%8B[7uWl3YBnqTY>c@-1l4N;5Q)e"P_!tDXm?@'4u:.'i<16nDc71oiD?9 cr+-Wf0'nRiEqc=glCHegfrI`$QF9_%a*i2i)[Cm:?l2Me^/u3<EXo74^j1:l('RW :]:8e:O0jllN_<-p#t,UPj:_1QQs3L,OuDms(HCufTbJ^=r_O&<K4OKF;hn/B<!#s (K.GcY`LOHp*'6`Hd*3h6Oi,4g^&%!<^>g</VuQAm`V*o5<RA<7XFB"?$hdp#e[,O e2=:EX]>'@[user]5L_UY[/user]=QV2rhm`ODJEg^d,F[I(dl.$Yk_f6de=cgWeKCML&OobS*E?Ku .QA_XWtDYeW.NY_]1cMuQjT!Q"fjH.2_Q#2GE/]]d[1AP5?*45>Gr<+S7"b:Mmg<\ m_-^951[Kb$71(LM.r2>O7+f7mo+]K3*5][6:L75m+*6&3LX#TW*,ILZn=6g:7JN- F%G/.W3a(K:"n6=U?bas9ooMc92;R):0+eMS^Y#`0uhoj`nH-O9#Oi?0VGlic#!I^ )u_b%&YP'9rh"h+hP8g3Zi6d/F't$WSq&\#^N^*Gi:-D5B!%lkG_&u%<1N.WE0_c$ (".#>(C*5A5Pe!UODkTk+l2\U?=*0&JqG!e#6l+$\s5&GZTaZtaAcc2i7!YC09"gB _,5p#W(Y(BaNT_o1U[a4B,Mu5TRrA@-C7UNqC'$;nVdth>1sfW37um:HR$8R;`2#K "<,9l8XNlT/8!%hp<<>L*7chUpK*kQc6.VtaP=s=32-V^FPMW*'/5IJ'2O[&2@c:@ 7E\oQK?`;(V%TmCrB9D(BFG@[Mi.kQV!dO9BY(!m#(E!Ln/5O6X`2:k;fk[8FN0,M Zs$n*5R@/E*`'U%XCOV[kusump+q&CWA'9,HikY3@.X5/q!9JqN2jgsB9MC[`6+#V N3J-dSM#-9Hj,^uYD:4*>QId@'tbSfo->l/V^J>hZ"K@DkW=qMTcYV5c.@@[user]rChABY[/user] g@8df2Gkj!3)VMGOg4$VeQDF?aF7XDDh8>b$f!=Gr+!)?.[D]D8dNM.DpKCCNP)uO $4at_18F/8c-2N)f3RMbfi,8UW(9cj;I$M5#q,OIOkFPWpIan-kMJ)lGN(JP_8,Og "Wf.L.MK^eJsjFn_sGAsOU2'Q`\9l:?bOB32_q*G0MEUD\^.o7^F@mCD4@8uUo:(k $(\_a(gP(JY5b\FeGBPc6po&i@2pf>Hd$lHS,MWJJ.21%MtQ#:AlXKK/Ft7II8>5g nXcIa`O:r(>t%@[user]daqp[/user]"R.,2MpL731Hfm\E<q(XK#^@[user]NXSr[/user];DQF.Z\?0cGD3$KSiU. 56t[Ei0($h72/,j&\">eb.&R/A4P,L$-N;m$8&%'Wh<@[user]Mg[/user]:C+gasNi`5f;T9eqN,O TRmM>8(=PhS[gE/7q_7:i-*iMB28HI3B8JU^AHa`h=(4D?Xh:ilC-G.RBNN3m]8CU HC2^F-\Q]h%5P2D`$oHTC_)u'>NaN($<+Q`_/EkHm=*j7)ISZ-jK!sXKQor&]#6Ht 8riFoaI1C#HV2MASqV"#([.6h?6_gq2>EN^$q2[o!Q1bdHhY%I2?fJ]H3*_IrsC%S <T@BSK1%$>92C1LCXrr!ndl/Eb'f5GoJfd`#?a&NlrR4N^M;iN5ej;Ib5<;E.^-FZ ,`D0;R<@[user]lc[/user](Q+5E+$rC\>_@K7d1&E>ZeaZ\U9/?lHFoiL=S*l;[V"@&7=TR)W\md$ ?05(>$GV?j'g`(6aECT=2A`LC`Zne'=JlBCYeEVI"mdf-Z!XEbqWR&p0ArVkU>>)n H)MAC\11PI<esfK07@6DrFh:FV%@[user][]6sHOC[/user]'\.+KXcUsXFj&6u<@[user]_C-h[/user]+n/n'(kl< 3&N['<3-^^>f&U2em7MY]l%,O9r)\*#/.,]?bq\fTdTO<:Yo9:@<^R,0\`X!lg;3? P#Uj1blAL=-t?pf?44Gq"o1=.P3#bi@Q,T:Y%&i7(S_k:3@pPuBa=kmY^B8F8OuHl 0f6S(@[user]F[/user]$'T>:!O-+oE%?2A(@%o;+g-I:0!Q4X_Pm[S<1kP;8g"EsUZk<MBU,+W3=, 1g$E(/!f[m`X0jH1.WL6.&<Q1kZD`:f&1;tA-1&#]j+%<H_V68\^r_shR`k3;b*.* SaFD`,Pn/g4UHI`LN[fJa,LXZZ/\&Vl17c\6>qL@"i3Ull:eDN7%3WqUTkE.mFmf* KR`JM=bd?a5rP#"WYXBf'Qrb)mknAXj,HqpcGPtkkr%ngS_J@gM;LJ^VKs[gP0%b) E]*Gt@Uo(VnL#f-p?*(pVXLUMRP/0o-_fqLkr*d>'&$cn)AQ5bPlOWn&0!#NmauPb M2u@jgpOJ@!fQ3j5<*nfbRf'>c*l:.<0)d7<6h78Kdu8_f%*>e5UF]0M.*-Ie6s/Q d>b>EL&NZk+@[user]`[/user]!D(sH/;==rWHE)UHj3:KiT_E_(+VIJ@IFb=.!&.G(\4iL!a;rs\Z FrM"S(YC9L3j[s9_BcggKM9ZidH$r&qZC2;*"<l,MMg)o-At_up&$Nm0%!Oj/b'^X 7(/BrgD<cI0ltiuC[2b`b$."gGY!5S=$lKDoM<S\#ruW<.QF>&f#E%FQ?&l_E[fhK pIkp*@;&^G-?#7*7no%NpW'p#k7kobN6'[h0^2;=Ub@(:(siJ8iPU/QJV,P`ZK(eN d24U!?.GGcjeA19acsqN5;uT6]r$Gg?HFOlU1G6HXd5[Q9:W=P6QrPsVR=c`UU#=N o_[cuQHU=nits9=PhmSa23.<?O7r#jXh?<qXlCD#0bkq(AYRHS5rUas2`b1C^`_oY HOjjmeG;p=-=$R7FT%%$#%R$"2@=2_hckX)*`,B<j+7I*)/qT'$^A47(@[user]U[/user]K@IACB" 6A]=?IkU<H-QW.gLBF>lRnrXFRuRA$NW4;7=$Tqg`>rIPhnj5.j.&Q$q:j<Vr)i'K 8QUObQ@$6bQYi-nW&_2g1p1@\8[9Zi,\V(n20Gj_f2Z(d:jPc8EISdHY>cA+nS_s= p^*Ld^h06i!F*)9L<>!eKC.$'M8\Wtlr!#L1edm4\Kom=X?:+`ie#6]nO9FfbE%%Z 3&O/e0014F^L4<6NVl2d:N]+8A];o`CE=sa2B;l;*>'ApIK3!!k<X\a2Sra]8Bfg? +A.ab,b3?kP<_K.YjSul_Co*,\;aON^WAJj*7r2a%7[N9P0&D67E9[]=iKq\cLT%n qJQIn(?WQs`YL+be456`"YL-b'"NDVcgo67-hF>fAECf+eMe3)mH1(<_*],9C8!\p Kkmu[n&)"4f59")n3:a&+?0!ZlJ?)uSN\5YFO<cf=K:O/H,YeuUZEk6AS!s'$5>S6 hSO?%<<(dEUCkXIF&+/'rEKP0pkXdT/;D1tBbnT28Ma^^WOXA\c3BI'd:2#R96*f( ULn2VH!l,ZVu<;+9I)<E<isP$Fo7)pLOU)5[jC7I^4F!tJ3I"e5-?:c2s!TA#^p5K *'lfj7XhA5>(F>_Gp>U.0KVR.2J<"/b_K&1*0$;Q,PIVTWGbk14aF)H_b&`:%:f,= Rcp=S'NuS/C?#5&8lTd`).^MGE#f;=Oq_2HoXoj6OY2IkJ%t=n0?q)>rE;K]rlP)o \U.d]l7_J,l)phJY..^a&(omIGN(p5pL+;)$7I%0`'/dOXX58MJ?+g^6Sd]6UH>#> GMZ(S55roqq2E^<o%`Y]eCsZTgqk?@[user]8\2H0^6[/user]''EGbjV+I<o7Lr9MA9[Du&'Pnn0h Q!niod8c1ZP3ns>\e?g++cV?!=&PTN/Zbu^%r.m-D&\2e`bt=[WK`i1RimEQT==ZU <kJf1_lF]C^.enlgpHeoNYNL>qRYXf@`/)^L?$7-dpG&(/N0+L1u*!=<d+7rkf;&R L"iOqIj40eBH`,GpP9_b)IJY$7+I2`NJPtM3S%)_]R58cAEEb1!`@[user]4sqn[/user]>'b4,).Z JfdO)I(@[user]--rk[/user]<?I]=@[user]Fbs3292PA[/user]=TOpc0=[E!pqMi@9(q?%nVe(%=,IZgl=<fjVDl #&A(<Y'=YXHCR/A-oa%G>e;-#Ytf2hGP=f,-(3`/Sm/*,HdML5[sA<T99RTCG:WDh )Wm>;W^nCWU_#h_^gD*"1WhnL_Kk2_)&f)s5lrtB&2r?)B(NZ@JN;9hpM('KF-c+. _h)B27tmbWYOlRo+3LTHGeEOa%ljm'*g<;D03keGqFGd_j[C8NYL8^i4h+)g.qm[m Tr#6>9rf3b0>OTOS!IAJQ2DB?TRVjSI!k.&V,O)'bn3hE]=9;Ds.JVWs&*.!;,*Wb QtbMPl@Oob@ZY(N\09M9T[:P0Jq+4W=EamVPf3e<#s0VZ@?i-q)H=KRZ7)BU+=\d> d;!Gn5oiG6%PA$^W%]gsI[U(EVY:Iidk`@[user]9hK[/user]*b$pYP)IGBk7`ci#[O^di38@nM>- -NrE;L?`)AF8\EUS)]U+$3+mkXi9E9&a,@=mYY%uL4sGG+1NbKVu7:^ahf.G?aqGr crAA4CNLHJrk^aX7iR0#X4ZJ1.XAqkA)!%l;T6649UNW/j#N7_PVB%`YFf_8a1:uQ &L$#)$UX3gXPVJc>unA:]B!jHo;QMlnqo9o:&`l>GD!M;X&K#s9"%o5GC750mkYPg j6NMR7*):/n)]=T"#3=OlMLUZeGhoC_j^<r_nf`sQ?g`6gD?=A=(AMD.],2akk;M\ iIMU?iQDnp;V[ke:264j)GaY?0!705.n-*)I&[YPE;<q]MV<m_%<VtWH_blT!_`4* 2;=3qHD("&3Z4Q464Qq%0\T+D_j#RpX^aeqQ@uV86n6/\#$#U7o5+fu[]#i.4pn2^ EtX,S>@[user]u[/user]!WPg'I$=5H$94]>H\&??8R(O87)cL/jIf&s>HV:uT['>A%/2+cn-?7L?B ">`/6KlgE6+V#*(k4pc@paeC^BuFqlL&,,SIP)%U-diqC5ElJo?+_n)K?4NY?2E7' 5f:Q1#=\LXn;;FL$V8%m.'(L-c$NQ9kNM;SL#3UjB\,,^4B+Gq=d>]JO9I%<MnP#G %gO,5/JX1Gbc3tSE;5Ss<V^DYk?o8R>;eW6[GoQ5$B("?OG]is*=2aTTa?1*2;^m$ /UAbE:tOjcXKF`b;jLc67HY^UerI+FIU#=snYE&OL)lPYdYkJq[s=X!85p*r4mnY1 5hR5IFTcF'&<Wo[66Et/j]/60<-2,\%q1qLKi@=caW79Q>j`Qmeh4R7qRZ[;<i&ir PU^B:<+s9pbHOZdVU<^9=`&Mhk/b`Pl]ii<V>Np_Q%T?T*,$mmn?HAQ@F'biIEH9r [ER)K.*o59i<9VH3kr[?'t^pNq>%2d%e<R%mIYcU]9r>d<dRjC6Y#qWl_>!,Qt4=e MNp-ujOt=jJhQPf,1"u]@$Eph9YqT?B)7Y:XrGIh"gEo]Y?dA)CDi9qQ^$;^;$:.K QIf]WjIB02PoMc`/sW0>LL7l/cAnQkDY3$i-T#"EX75J;h56TBp\;='V,jTq;SE^/ M2aS=?2D>?2H/Y)l?(r[9,3V&@[user]PT[/user])V-:D/nLhMkWq2^WTetoK@s!C)o4q2@b<:V!e [rJpuKnLEmIO3+aA@5_?TN7VI!skAb<oPK3maFn*>C4;$QgeEsoc%#L9p&5Qf71c* Vg@b(9UFb:.CbDBnAr4Dj%j=tQ`]a4cB)T0m!YXl[jiKgs'AD;q&^l>,X>(&"d]L0 L7c7.le[)X&"eY&k7,mE6CZ7uCmAZ<_ZbB,/cd?pT#.(gigVBfQ%kT6fSe[a%;p<D YULFO.`n^JX3HbcA`$S>WlRb--C^$-5)'MZf%g'.LA_D4`J*bLP/&Q&e_1h5))?uC FeKg[M(P41/3PM=3*8H[Uk^&AN.npLc=WMaH50fI.+G?X)lI,0(I)#<[#O(0TsiCM _1_?`3\)/Cnk6]EZ;<`M5@l)8R&?!4a.F!O13LG$\We5#'T<r$cpDO%.+Za]L!=(Y ^dQCCMt57\L=ESc+/&F6MMm$b5EakGK1sBFY[p/h075BR-#@$3Hb@g41F_^*R$qm= #$8*JbI<,PK`'u+dc=G4<qc?o)TWZ.8B-T=\Wo0tC(!iF914nH6lXX4DkM;K.qG!; WmMe<S0M(<C#913@/dOE?4LJNfd&EG^_g%Dg&:Yn@+GMhL]K:j;El'"p(Y_Td(GhL *<oF#"9gh"\`jb$4g+%P)$Do.P6O?hbgOXX5`c<&9HFDobg+KpT5AQJeqd]"_NgI. No\]i/@IhY'3,"o<>8C;J",]YqfM8]>CD$1Y+*:=]\Wl,\9NfgJ\bRldLjV:$s3h1 21?b+^r_>QmqVV2UjsD5h$`8Q6jPZ$+l$M%@[user]m-[/user]/3>(a=1d2FqMmElBWjmZ>mqDE[H r+uAZ8+5GJ*R6@/'Wr.1ON-'OkPbLA4,#V'qK[M#H!HJ>ch*?J0SW5P74'^Qb==T; acF81'!3km<7a=j.l?:9=WA]F5o!h6(f\n5'e`a#-gDrQ3*e]Hr3=sLH*qN@_hN&B i'<$:9PE_RRlIp9)]9.%/_$.H5_=@[user]H[/user]!doXLR%pcB:;mN?g5_3m>;-ql^@[user]l]6K0i[/user]+: 6p3\db$Noe*57&%G%u0i?iT+%]0<;NqT5MUAZ+XaVpGD4["CL>9D%k,qN2KI3L&_Y aHI6+E7g($bfSG,4AE23f`&Ou"`.T3)c$]!W!%%9QU<eB6YjE#'8Ah4X7\-:mG]3. *7CL)nrHG?[0B\XP8ZIe>XajWXoV?,78SmK<'%Ps)Z]!DB%qcE!-PWMXhVsXC72+. C+%IL_'>&Qo+hkTZ1JN2fWd;&cH^lqS&62/g=tp$Be(P;j4QT3@\/8J,ks&M!lYQV 5U67N(h%A2Q*q:&heN&m%\?<>++lp%]]juUc%_B'1tPK_@rb\H;]4\IIB?TlnFIE1 cOis6f?<]PcBMaX-R<cJ@3cMPG4A59'KjSZAh6E+VUKFsk]kWGbNmJ-Qd(\geGNir RI?;(`Pr?'[f5dFR>MoW?[=H$ceqT4gBG#=d(G:*C(;iJKDJ.4"ci)j=DG]]Xfj1J HNQu%cV?)ta_$$<$\_Hn*hTUIk]2QnNH3hl-jMiiB\LY#ia*ZXk4NgDOlZj2a;c4d Laf^CdF%L\Wq]a<.idZcml+U7kdo8(2KhY,R2K5ODVWsUBItoY-N.HfrOqpdpU+hp "b4"=r`SsWa"k*lGCXPhhnjleT^Cd3hhBa4YPQ-[g1:$6]^E6jYUq+#Xfs+_^2s"h SS)#rm<n,leD1Y5JUULAk%3Z5)PU.^kJ=mp]@[user]ta`BB[/user]=V5!<'ViHARDQA5Qt$hU5?# pFQMNhtp>Fo_4<"he)pn`kR^geis4=J*$D3@$(@?qp"rs#I"J<pRRB4pEF!DXO6^M =1+ptDr0At5jMbWXdA>LcJ9_SO8V#T1mdT"Us?[2#HY?J5")u9\0NKQb=/ZhrN8/% b!l-p)Lmu?Irg%)qm5G(:F0CQp\ST#Qe9IYJt5o.0(,79CjGAP=*]mK/:l*W!HAUR Z*ipFa>oT9=+QNL4O?*HJBfSG-.N16(P>nGlug)9V1/mN[K3u&*md&t?/KpRjLVr^ :6JMHlFq/.eF=%g5q[JUjr<9JU!P4>g7@%H[I_$"oI3l'JU'(IoWQ:/TH>1YrcHrk aT\as3td*&raGiS._=8JEb)+EF)fU\epVnj:0din5l\[.1GDFOl2T.L%a9_jp?+C` NZ93^,R'/PAScAY'Gs>XYW1&9a&+$/Nae<aqa0<+,UABe(`=2[j;'HKn*Ypl4R@-" bhRp5(0Dp&o5HnOHGKK[7c\3D-ib2'-GT~> endstream endobj 49 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /BAFIBI+YMjO13 /FontDescriptor 46 0 R /CIDSystemInfo << /Registry (Unidocs)/Ordering (Korea1)/Supplement 1 >> /DW 1000 /W [ 1 [ 390 ] 6 [ 830 ] 8 [ 250 380 ] 10 [ 380 ] 12 [ 720 400 720 400 479 646 505 627 625 640 615 622 606 626 622 ] 29 [ 540 ] 31 [ 540 576 ] 34 [ 778 730 735 791 733 ] 40 [ 816 ] 42 [ 435 598 825 700 954 843 810 703 817 765 674 703 ] 55 [ 770 996 ] 65 [ 195 623 631 548 636 579 466 643 686 378 365 671 375 948 686 609 647 ] 83 [ 516 542 467 678 625 846 640 619 558 ] 95 [ 810 ] ] >> endobj 50 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /BAFJDN+YGO13 /FontDescriptor 54 0 R /CIDSystemInfo << /Registry (Unidocs)/Ordering (Korea1)/Supplement 1 >> /DW 1000 /W [ 29 [ 500 ] 31 [ 500 ] 65 [ 250 ] 100 [ 250 ] ] >> endobj 51 0 obj << /Type /Font /Subtype /CIDFontType0 /BaseFont /BAFHOB+YGO12 /FontDescriptor 52 0 R /CIDSystemInfo << /Registry (Unidocs)/Ordering (Korea1)/Supplement 1 >> /DW 1000 /W [ 1 [ 500 ] 9 [ 356 352 ] 13 [ 321 668 321 474 698 469 623 645 ] 21 22 645 23 [ 655 581 664 655 316 ] 33 [ 986 772 736 800 ] 38 [ 700 669 ] 42 [ 290 ] 44 [ 749 648 905 793 ] 53 [ 670 751 ] 57 [ 707 ] 65 [ 250 652 693 640 ] 70 [ 662 341 ] 73 [ 664 290 ] 76 [ 647 290 912 664 662 692 ] 83 [ 434 595 341 657 ] 88 [ 847 ] 90 [ 618 ] 95 [ 937 ] ] 55 0 obj << /Subtype /CIDFontType0C /Filter [ /ASCII85Decode /FlateDecode ] /Length 1868 >> stream 8;Sls$W*$W&5F?QILW0/aiW!R0OR:6"KKIC-&>a3=@>UI8W"oGJe+fYOVl&-RlYDo %^ag7dOJ9LkQk1i+D&K+Q.h,And%Z\&N*O#](`gdCk&[uZZe?P\$rjDICF6b_F5f< b6Ps(VbW;B)4EVRrQ+3Z"Wd2GI\4.AMm<1[JahI>Dg@QDOQO#;Wr[G=?pD-PmQiTE \XZUEc!IY3-[krPS95^H8=@[user]s3bPY[/user]p@fi!*g@_\X.nWfhBECNekUAC/L]@[user]K3Os[/user]#eg7 <MmCa<@[user]7[/user]/tX-IBFpG*Q,BXGu+)^h+$X-0OF(AW6$[u9*SMp$7p8Cp2[(<()Y[p,"6 FDN-N.ILgQOECC<4=R.YUi*kM0i1[9,YK)K%f8Zs9%oNtV@J]@[user]9jnJF]Po[/user]!>&\Oe3 J#7Z0!se%*74Ya\KH?Z!P"?qUUHth5@\+j6gFll`ju29e*dANSG^T%G@aOVgRF@e2 J05,:r,DUl^'k,Ai@/Q:]B3:\$;K<qkkkRQcVS($K>IFhGk!^S;):Mbd+u^YESKNa /OMFWZM=nR[Sr:"k9Vd-gBi5W6QKW#n/R.RU-VT'@[user]2^^k`[/user].e$^L$t0-S'BinZo-R/ nSmJJ*`od8malfdr7)40C%UG]D$ec^S7T-OA`'=S*pmb*7G:Fg7bg\6-kl8iR0/X] +ON3i:o=LuZJlg4nU9Q<<FX@flib-:N2("7i1pEZj838PjKD!dK)rDq*^Uh`UAP+Z ()OIVX+b^_90\<d(2JogbW'k'8=RqE@]P*ApV:0CChb1]WAD1?SL1<$_)h(31N`:9 \q#Y_6rbp>M$gj;,7!Oq!rpq@:2I9F;os&Q\7GlZ2/^=-SZ=c,kVK_:`=O!k<EL"> o>Smr3"0:bV-W$#^=1tklPIg9fO,M)aK?4mS9;PWC-h-Foc/YYfbX9FK+3-]V,/<< )T87Ec0>a_.YRUg&7;3+W/9nof]-$,1[qn'!LsC`\.Au+`tX;^/YAU3,Qicd^lq^) F^_0oLt+g.##[TW_&.cD>9hN)rHp=Z*41e7$bF+UK#+c\LZ8p?K+U-b7!')j.!VP> 92oF/\k;eKetB[^UDi3djje/\bGTP_YE"Q68XL2jPL/j(qW]*8%f@a96[skiUPF9- QHVsZbD>`.^nD5T#QoF"+L(8-bdj#<BCT77mr`+Aq/k)W9cJN)+.7=kiLsSZVp5:@ G_Tq6L8Y8'H;`o+\17t1HJD7=68W/)Or]*0;CFUI"NtdD7FfcDW5HF/Vk=+Ahq\hL \t2_tn[_"F;_LX1VBj/UY"A!HXM3K2Ws'NRcmeEoQHUjdE66jVED8m<C!2Are"WZ! )=u<T<fF`NFnPC/b>gL2R_,DWg3afX5s*iu2D0qi)@[user]hPS`U_R[/user].Y:Ml,a#+/CFeAh! 7nT:IcqAj6<Ucl!D$DM!F2S/;'\;Je9dhO[`jD(odnT<bd7EFofW`tLcrBGHr;57o jq;b/\u_`2M_[u:q:hh&nLFFAk%Ia@GHTr;?cmdNXHc3kE&^EB8ZBql0:9o,V,e)[ `+5m'[GiLE0W^<cao?GDT+L-6OlHS(6;@@[user]sE\ql[/user]#!0;jnjG8lZ7JeHS_;hWRYMW?+ Tf2fS#,6!'mTc?C&k5fAh?PD/'6_hMj/Pnq'hpm[4mc@g=j'+S`YhG/ZX^>]=gE2s hY*uG]WnF.7.$\*dZS)[IWJkPSqr.m8Tn[j`=;N@2_F39E,&E!KMt!_&'bjX`(VZ3 hIEqrY%&rHQt.8X/j75qTHRc+r[cTqY[:U=]<6Z*6JH,k%+4NPQp4f0SMUUaMJ)r' G_5=E6Rtm-d8>h.9kickG<DfdrZeW7/bE6GYl%jtm7m&Pr7[2?o&(%>rEtJ/^UF,Y W`Nda#kYk4!(%P8W;~> endstream endobj 56 0 obj << /Filter [ /ASCII85Decode /FlateDecode ] /Length 99 >> stream 8;Ued?s(2E"AD'3^jmFZi=Mmr=MVf3+@[user]2_C[/user](7M`9-YNKh%WoNVHo_DG,U:F>N.On\ $:_i[(^6[B'T@W@0FF`]!!3Q/5!9!E~> endstream endobj 57 0 obj << /Type /XObject /Subtype /Image /Width 612 /Height 225 /BitsPerComponent 8 /ColorSpace /DeviceCMYK /Length 62881 /Filter [ /ASCII85Decode /DCTDecode ] >> stream s4IA>!"M;*Ddm8XA:OX[!!<2T!/(=Q!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3% !<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3% !<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%!<E3%s1eUK #QWfbA-;oW!!3`5!tbP:+oqZ!!!E9Ls24r4!!!!'!WrH'zz!!`c6"U#,6$3C5.$NU5- "p4l,!<<*"z!!!3,"9Sl1#QY53$4@CF!W`B+!<WE*!s8W,"poDQ!WrQ;"VM"_#889] #Vd#Z1*[M?;*l%,,Vp67EIes9OX3AgZ1'(sEXE]#d5<<1;`96tP+k?DF%&PW7q3rI <`^3F_U@H7A:nufKOppb_pdWp3+hc).QKO\8P3)f>%_M_C3FfGH$Y1!LPUeEPa.Q$ R$jD=V5C/hWN*>5[^WcW]#;S-a2lBFeCE.%f\,!>jlYail0@p6p@n@Xq@N]/!<WB+ "9Sf1"9\o5"`48A!tbYZ&d9uo!$W(B;$Sjb'QFCFJKp9l;P@P81C:<3_9kVjn/(&8 1aS;`(h5u(U9Z+'),rL_A1%_*K9JcH_U@H7<Fp;R2hZm[Zbt8Po-kTBUpS(ijRe_6 [Dg\XodE=3AiOsgQDV+1f&l[=GDDN_\&[+`pIJD"G_h`c\B*=dpc1oKBmGQ'WO^.( l1lei8m5tUMOLQVb1c.Ws4RG_"9AK(&H`UJ!!#4`hrEV-qqo*aYBBI:!;Gr2p[<S* msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pg p[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*a hnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5c qqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S* msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_ p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*a hnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%m qqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S* msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo; p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*a hn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$2d,3m@^&-^#qlb/6 rrDf^IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE ^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9D f=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$" IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!U msb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE ^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g: hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$" IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P* msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE ^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sp hnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*s3]`a hnApE^&,!UoD\gbmsb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S* m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[ p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*a YBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^# qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rs h0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[ p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z ?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^# qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H ^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[ p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2 IeW;[p]&\!j57QIhnAojFn>V5p[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeR msb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE ^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6 hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$" Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S* msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE ](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*a hnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$! ^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S* msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAoj FmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*a hnApE^&,!Umsb$"IeWlkhrEV-qqo*aYBBI:!;Gr2p[<S*msb$"Id>g:hnApE^&-^# qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF ^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[ p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_ IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^# qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(= ^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[ p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$" IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^# qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE ^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[ leQpF^&-^#qqo*ahnAojFmjeRmsb$2eDK<D^&-^#qlb/6rrDf^IeW;[p[<S*msaTY Hf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S* msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pg p[<S*msb$"IeW;[leQpF^&-^#qqo*agKmf9Mo*=Yb#ZDNNI:iLBk8bH_AHbn1o+A` `f4blg>h#LN_*MdM&o5*d8DhSm!Sr6,bM;_T'l$p_VSM?l`5@o8/GP*=&VV-D[KGQ ;U%!CENMbHFonHL-a.mk^O,;r4T,NX4:h5EqSMFMVn[Qg>I:iE^4:5V[fad[?mUm- XRe!/+&i&_^Rus8C5b@=_InE:b4qm"7]3/'nC4E7[t80_)&Ig6N'(L02=`o2T5<:7 U[`!&\V`,\g*[68rZb#_qeBa`H4K>4n]BP9fWj/@Rq07H@R=8QmM=&0Uf<rf/Rdh8 "Hs+1##6u+?N'=@[user]8C-Rg[/user]&,?7Irr@?Mr-k7!VE/G=Srr'5#R`]3:R)V5(MI&)\cEoi $<$$?]t\pg^O,^^4USc=p[<Nq.S*r5+&GC^pXd0,pU#?lqV/AW%7ZU=A1H%(i5O0e >09gtJW`)[=U62#8m)G+Kfj_&6,3-DFQ/P8b<]$18;ebr;L5N`-;n"MA&X_p;JlI; g]c_Rge</FZFM^Sf;l`;J;T-29j0!:<7=W,Ju>2#3H#,Ygs<6`ZSAp$*QlkBW!8"2 `A2[F;@[user]dKNnN[/user]:Yo\grfSn)!ZR:FtoYM&oe*,Y&8]1mT4^U,?H$kPBXUaBB5I(d,n\ 5WVRr$M<eei+Td'W#X]J//XrYp9aS_IeW;E3Ycc>hn@+0V5U2O`DI;el>0J:*<-#D pE/;+qq>g=]5T`4Kf*.J]#Lrg<0=jo:a_>G3(!t.";P'C2IJgI_qRjjMmh>^VlG(@ CUL6a'JdP<r<Xl`d&6--_Pm<s".sA(gG]FK'$"R(nWhV*Ydr8u`.F7srfVjsI0K(" gQX6B)T)6:G"Z&LjUfZFgPrKU-9NH^@[user]j[[/user]+J:R#q-DKtED?MEo6&ghd%(Y$IITimqC q>cB\)u_h[gnpcYU_-QdV3HKs<C8SZ#O"a$oRlpN!Ir,Eqd'*n]Pu+)6rD85Z-<]W *[tQ@OuX,.eWJ4DAL$D)+T'5S\NBo7-h6R9";1t_K0fj;"CQg@f"PDrQ-mui7TW)V kj$!HObT]D?q=j:5n"&&)M:eXqtIXd1_hj99[Sr^Tqd`@[user]B]MP[/user]%A8ua7,EPleDpPq: ^B9\ghYlgTOmF[%Nfg#Mp8aGb%[7P_8qIM.oD0o'JdoT@`-uRD\Fb37[4:5L[8fX5 B%!ea9^*EAf"@*4dP^4\8B@ODYl_k2%B"8\r)$mG;O%L&P,)!`$Va#f2$0$+,:Bu` N>:EVPFK+.0#RI$)fE)l/<uogjmd^4O>glCO>(S#.uq=3hYDjIg2Ogc@`SH*>OhMJ rr<FRcQ!NfFGd#ZM6QQOU7_,8`>!f[ZB+PL^A%)@[user]ig[/user])%R8YD5,Toh^_/5EK@+s')r Tdn2Td?K`B#Mr6fj:Fj)JdhuF+H@S*?A6PElE6)IN1lN$L/q=i<`Tq=80EKn#fu9a ^O);G6W6NWbnDS:%$!JJaFmi)*H%s[3=M^85<e(RpV2(L[euFV@k#AgUW?L=,0/Z^ dQMG4e/7L*`^>"&9pu!<=\%Z3d2GMS6)iLeUDYH&1`\GpEt+oXgt]spJcmi%+Ug[] nR<1g)L;BZbHH9e^O+-41/?ggP"?XT!_/.oS""AQ$Qo'EgP<Oj5YKclG+HiWBpGHa D5mrEFHK7`j\$b+7\O9UW$(uSh4qAW>WmG+od`Kt5Or'8]RPhMn@u:AZYlY)g[9k[ #`4?[n0,:QI;;Ge[-/S1j`1buQ;2>M@rrtYDn&,sUG'Qf'/5PR*#'kB*"cFuMr24m RZ,]UMP[,GQiKf;'[t#FL)3b/a`%OH)d&+j]KS<ij^Cs]dE-n4Plq!JfSf4T_e&40 Y"/_:C(L$,Ouj3E3bfPIgF;il_sZp,S<-$ta<OZG8>V_"VOadp4uAZ=9N2);+_`d3 -*.,2kr.)&5`I&?2^oZ&Z^@[user]8_O[/user]&fWo;=c%CQ#422aa;"NG'e-aCj1)E0M$%jgb$L` mW]ug];1WNnlV10k86?ip[<CGE1cqs\,,VX^YT8]miLOWO-6<EdRbHPWg5@dV3J!< Yup'eB@8eW!ORAKYS[#0p[<S*mq)G*H@bPAq)UWS;:MWJ5m.a:5M,YMhnApE^&-]u pKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE ^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9D f=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*agI>Y1.pEF%ij0`C U^kCI^PBXeBk&Z$MR1DC`'O'3>IWNplgF;C];d]E$F-:f5p8W1ikd,*OSX-q)NfnV KX\E'g=jek"dRBn1hmA#=hU>L2[$?j&O,/t@qMeC/kl"YY*E`VI43tHmsautL7j;H <g;'6,n`9>B6\g_!W;`jOl-+q>MHD*$^(K3PJHqMZFu^*c*$.FN4*&r,a?tC=BI\K 78GD?Ye%Eo/!scuNhh@3NWu7dI@;6iS"A,Qf^.DK--+QUd]&3D;,@P@'k\\Z=F0'A J.*&b!5+<;l-@[user]nNbA[/user]*M0f$J\[p'n`H]X`W0R4b&6'&b*nfK9`D4I2E:Npc.C/As<D K'bf9C]Pp[!H[_K9(9WKrZI9r^M:jZaU[j7g[\@[user]HD[/user])@[user]Z^AJ[/user](kt$o-71el5QY+H/*i eJ.q@9L62<D1?=bl._Fa?[#N0kS,R%aN+?':qV/L^O,^iHRS/IkTBQfIeW;[p[<S* msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApEs4-#ehnApE^&,!U oD\gbmsb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*a hnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$! ^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-G"9=<m<gQ-;a10)j4 NQ:-qEUX7g<3db_3(eE6:smb0'L"MudBP8^$`T]qNdf_;31=Y@.oOg&cE^F!e]TN1 N@^:D9%(f+@[user]u_hoi[/user]=IPUA46`%?&>,,i;7n'Nrs(,R:;$k!eOp@ZS]n&JI9=F+S5$N 1:7+2D<2^cDnb?!D:TkOY\hu.gQ(<)dn(O'[qfn&^=`q"`9>XfO$1b2K%__mYrH9] X*`Lhe,<:#hZ!SqF1]%?;hs(rIT354:^DeC-Wctbe?nhs,d:0:$mmt^R@pL"kD^^F (277[(>=KAQP]Z%>5lL^\#hhMA3Seh1l0[>'@[user]g[/user]'o0J)fp>>Z\5MZm+?5Ysck!_WSe 5#/?9NsUeSXbk-'SLYs@K5];;;'Z;DCgjdp:LMK+_;oc?C**mXfF_,CYE/D5O]tCY :e4`!5)H&H,GP<0M0/VP5/FtjBYN(&L>HuK>06_2699*>qS9Xsn]=Z,4e?]fmsd7U *M(F&?,:V/8J6+(l(h)NPdO%gh(H+^:n"LOUf["4[sY$]Eb4\om(68a0CIR'Q5;HG >?"7(iqSl6ets=JhnqsIZ\`(^:XhmS'RF<rdOPX7Wdg#-jMk'UF7;0fTpLCNeNIRi lfJdZX\Lj`q'slT%>BlOJcY9J>4$^U'f\mTYK'70?6:F-A!s&lde*3oK(5s:(\(JE $U[$OP%bNR@RQ>)M.=XQP(1FIQLta[1"3`M&_&VUIWPdR7%o+'@[user]O[/user]!.I8rr6'9&$mR S&44VRT1E/$d=NW.o?te2%$h'#UYR+!0VHXjIUdm].\0RdRQs>Z*)8QP>Kd]):KeY 8Kig*,@[user]F[/user]!,X-Hsqg^t63&#Nf&PHUrrUtSq9PSJJ,HE/.+FYtsJ#p8*p1iNBo+`VL? @[user]89]fP3j[/user]*OY3?^?)ZW\l!0eh#3np8uGbf%<"&kcrdCl^*htQ!eqA&D+_g-5?*2,(/ <Y[flIP?![(uc$,oA;=l,MN,lJBogMpWir-2J_''rr>gR&\?VjqjaW[4rfc#2X[rP /^pYn-t"9<?,$bUG5h'Q^p$[R.MGYJa+"d<[.DO2ObPW/HuW4d<(A"(=N7:Ahs)-/ ;pSH,4Y8L-2-!o/e'l1+Y">LP720HV#,rkZ7Ha"4*mF?G`/H?7osHqtKWhPQalZ!' f+aX#`H?ViLB*U/*Ao-=e*A^gPmU&Pe<EU3g:_c(l=>luDVgsQ$02O9*ITe]b3@11 .g,U(iF=L\J:3EHG6:@[user]EZ[/user]'=l;d@cRjL9@0t&lhnr#$GJdeAGS18kBW7(,b'!VY^a< dq,bk=U<tda^ZH>R&<eoQC\\kU7P6djBi8+_@>0E<<uT25f+&EF$u52/2@U/dC`46 jWm`_3<X@/qLUrLfb>BZbW!XmATKPm9-`^ZO;=pRfucA+9(:8B.?:6!f9E^\_j)j" 8Si7=g=pIk$VPIXpi_UXPdI#5G#*$/M:,i/SgsMhM\8U5h:(>/3t"?_E>5e1)?0]E M6cpt$>$6@A-SbpljNTAV8Y9%OUO8q(U_<f\2Se>k)*`m;*uC:MDq.LOGQsaOsn>\ kc+ulkCqnsBGI\se1-iR&m:N%cM>T*Ol+hmG:]^j0OM!a>c8b3]n<[iGcIEd^l^q_ !#9"?LX>uc,M6#H]7t(s3h.d,L.QC+P>SrTcI>VC)Bqs'Br0/fP&->X@`o[NC0gMB heqCV8nJ/K>5nS<6qG(KPq=jfNsEKCke5$)imb&uP_8pK.oPg1BupA$9j^NN*ZN-3 W$$*+Wg#I&KtlWde$gfcR@J+7mZcAa4hoLg=&CHWrr?<#/4\ss,Eqm<ghe`<bu$l+ I\(5,r/lQ_g-^T/i)WG0"i`h<^eeEKhTtU"m:GW!p%Z(apWhH;-Ri5)Z_&9l&kc^C JkD=Bfkkqe/_kP#gHroU(*[YPa!U?1RAsj"ZTDJACLE?Y/QNd50Y5"8DrK5Q'G<3/ `ENI3b6YU]aCAik/BHNsrmf?leZ\tc]o@FC6gra14-e9agA@?Xl#CEdg4?RR5UpnZ nLH!fWVsM3o]]c$F4,psc##-Md8;]J/bP6fJ'aP^!+Y@\lhh/j(jIgD$0B=kd+6NE 2ssEaW&ijrATH'!OVF6_E7.<&CFuB!UtdpJ/]3U;L9<?c;4<fF_oYPKV"j%@[user][\[/user]*_) 8:uaDe;Ok3EhS:T77R=]6o;:@"X?T9*(ZAGp`e:uj6>u5Yarc+`0^%$XK8^abJ_P! l)M#Xd6/'U"Ui4=Tc$"((<t"69qNk;o";Cb9t).G.nf2R@ocgU-%UNNio6]9EH=-c jHuPQ`bfJ,JrjU<rZ_m&*G^GdR2S&bG@'U1>bhfi,<[)'X;Amo!Gdp&kfboIO;6J@ b"8RAMu]IrfaGG;QP$a+TTYUaDmQGLU8&Z*gd>(;+<&^%>K[R=-]:r%!iLT2jP8!K >CsX;W8Y\RnTa\[Qc<N=8gn*RA$F>&,64QpK6=E'p/AdW5p&oh+7"qWYR@QhFZA0p gMX:K5uR<U;)on#A1</!'edG*ko>NF^hH[j[UsAL^<)tN@4:>QA<A>sfkOc8R,+NO UREZad$A!3E_<R3MgILi<XbgU$?BMA1U8%]3^R^6>)'<B9iUW.16\Vdb<)bD8-JKS \M1GDRV[[Y19.%FeV^>P\p0@!7.[c['"$VmB5\Q[nHe39cXQb&e*K`?28-H_[Vjq? KXnHo[m7?&\4Fdd,Pjj&<^'L6F&HF2DB[iFY!qN7Dai`aj'pp63HF!@[user]VC[/user]=+*cZOQ< gkCsO5>MtTS<0Y;Z<JN+<DY%/$:scRQ.mXu.?_-2\njI9M5JI+iKg?C&adM:[*VbR Krig%;i$1=>Y'd#2.uGti6]JI[X<`Fl?L'8H0V7\`1Kim8YnZ(rrB:sUtE)i@G*_' ZoCGmVf+^a,R%q/Wp3$TNR!_uR\"6ROQe#@[user]Yno[/user];^`,4S&rMSAW<L$21EVUr_VaN!K cP&n0B*CjN2K9r*AKfSs>sVA?`cY;hSco$=,u-e&W:D^deC<d7j@(%hQUj%9Um6jd FJ\VaIF$IYED]M;J9lp@SJkS&RSPb]7"DV$Go;"/0MkBB]W3I^#)50pdI5$.PJA0$ Iic^Ajpfur(3=aPS\VTbCC?$]4<QI/,8EWU]MsI`l:Sb`KA4SOSmA'S>2-./TP1%S /`P6j>KNP>G6;er2cE9e;F7i+9,+19PoU0/,ZSuJ8+j;ORP!o.Q/12P=;C,]VoVGd `RDuP$V*bl(QPnh1T1UpCE1T,rYTd&J4I1orr?27.B4l/qHT%*.8I&p_;oB#I1:9Q K$P/@7*$mXlSRD8[1sEr<&1Nt5gAC=%IL]<gtA*rS_96s-mnZKrBD(,['_1Me'u8l /lC%bAS!bY$pB,(=h#q(aW(H3(Sn0)V5-RiIbq(=Bqu>GfjgTfQ)$^^PnB>$UsqVU /K5=i<UY_hV-ie.BsKUfO^OEj.H?2DCo0dsO6aT!%INN*qch=-_OI",C([AOMJ8B, *u)AG<W`A[,&6]s\E0d<BC>SB\6X,#f(ZJ``#E%[J%"a.0e=6[-nM8&'/j#"mOg+- ,>tJTU:OAJTLJ1h7,7B7D!I8u]j1eiIML,OPkE\oGq5n&M#JNrU5#[\:-bDB2F%\W (D!ecP#,1Y;G&M0aN-m#kXbD*r--)n?aatI."gl*f\Of@a=uR]UJ*Of$jP9-9B7iB 'Z]HH28RcB+iaL8S^j#[>=[JjCOJEOIni0(hnApE]nSS<qF:@[user]I7oq8Vkr^[/user]<<KFu<G Ndi,0qtIDr!8EXj23!qs[Go%=rr?'YX/Kf`a?Ei.!6AO7KPnGsVh]$HB,(!tU/e7W 8_+`sdV>qbdB6auh3'?%K$8&2'RE%<JF2h#\DdGfl3a<c[uY!!_Z'Us7go=s/1:Gt grb[f/]L<[WbjS%2-^;A,ZH8LJ.JTo1uX#L3l\m.[=eGa+)oo.7kniB=Nd_RLEt;g laru`CXndW'Q#D<^!0Oei6Bg8gE0L$@[user]l[/user]+mSLc?ZGMCIYT!PeJsW-`OVDlNXRXEN^! l]-eeb_6NC'Q\Ol>ifO7;E>_9>uG7hR?+cQR]d@M1Xja"]dfEjZpb$aNT*>+Q,!5% KDlB?rH%[E\(CQ!^9%>7[5EI5mdbhV2;$,r:*t`>786i&WDY+#*.e&caO_@AWk'ss Rh]<r50G#8_Z'UY[gU[49.EB-)Z4uOQq\!,m@XahM.e8o8CBar&K7trAZTX[QG)`d gS8tM>Y5pSL+%%`jrpZsnN>8oi/Rq;b<3qqPFtDXQWK3fh)Rr=`SC!MDk^HM*d)Z) #fnNmcD.(8NBj"623UkH<VM=(2OQRHC:d,@[user]^[/user]T@"pQ?J`[[]pA"G="]aa0n>HqMF31 i4'fa*Qbbr<TX>2F^<_s]l`"mDdmc%15ueZD&a3C6cJ&O:RVS+od%o+*3m2K2c]p/ M`R(:=b"#u][5#"ilGVpUh6R"%a9CWb^E6#B9#OBPd<pN/5IK.9D_N^I_jsK)m;,V gR'H>ni;)NZ-^nH5c'n0GBk4b^J$KVkgE1(;'B%UWT'5<B1SeA"4#ZC5$nJPaN=LK VNi'8$Ni4r`A8q?.n^heO2)lCrI)BVCr9a]&W37$+Ufd`@[user]YL[/user]<[#pft)V#^'KZPSe^ NE5c6bc%W2b,D=CR>=jC;0HP]?k`T4,hNT&YeA/<Y%KF!d:q\rJ3VE)NT#bEV5?;E [Um12A_L(*E8-U]?&J&J('HMc>!t"`YjERY,],mRNt-g`rrBOg3";q$C#MT]ET1E- W(>N.CKh`@/U*%f1rO.eR)YlY+TN8[;$]=SDifg3g=T]/f=8tZCB":FfNKh;78tD0 <S#,+CkZ&d]->g-4\\a?b5$XQ_'Gh,8[.9JIJ`cG<4gQcM<:Yhpr`!C2*',BZp>kU `8(2-^2MaWD07S.`p*pVYTDK\lq34:6r<:lYE?cD.C)^6&_<]fUD7\N1id9Ch.)`+ <.h!0TWF2eggn:VpQa5OBs#hAXXd7bnu]_2A5YOKNe=fiipq5J10e_`/Hjo4DK,!T [FWL,Gb,M,pWI=Y[WH)Eo[l%jdbq0'JHOd-mH5.5bNC0bYup;8K?%mXg;I;WomWMa jG7<rA#EOhfTCM&EjD0M-\7F/oD$P$-dR8NdmC?+/Zl'AWYR#j?Lf@>8KoT];q.Lo hgY;-+-E;?dR@G-:mElD!`E"4e/L.uYRZg>iR-1]:BV2U13m%32'^]5C/ULk%CJ(: 4-3(T'P\$!.fa[c.:N<9$4-u#)2u90MF0;:&&HWL-])#?d7mfFNARbb\eR-`@$X$j )YVR%d;CT:!-fH=7@2Ge&dt>3fALlX1)rrj_^\"XTs%&6IeN)/M5[8&)RZsEFT@dY U:H-QSLcF0X.oa")[1=k<KnOf[=Ni$+&hREhn=fmDbR#o52umT13j3^:QDHPWXNpl U>W[Mj/<SB`IV)TS(W?iL-EVRVlNDumMdU/WK=-@.LG)QQmdAJ6S$)NdR^'o9t9n* qjVRdK%m?;!m_R)(=Gs.ES#)l2!RSuBYaofY<au47jam_k1sUW[^gKQD8PmXhX's* L60hJ"*hE3U"\X1if>,7,;4"F\a-GJp9)>MIFXga'tDN'PH:Qqkc%\8St8ab;IGrd W_<KrVo>[[#UBsHJR*l-`RZA#.n>c@f#agX2:RS9_`!d)fDs@>c,.X:3YV-L`.*71 mqhfYr[S'VRjD%<QahbR#$RIMqItZe"lGIDHO.u\Xje<e08_2*O^a&(Q:Ec2ND$l* P,KZ&T0\[$L"EfbHYok9]7neKQ(>MPT'GTSi.<8R'p;^&;//X!;c[?A<00.Kp[<!& 9N>sSWTbq-BP*4VQ%9&[ooD;keOtCI+F[&,2?3bua8>r2naG>]1N)"J!0?P^2Ek;Z 9fg2A<C9DY;h>:K81LJ^WP4L9p_W[gDt!TfEhlMm:Q3B$'O"\R3b=G'<)H>t##IT, .8h$#M^#Fdg=FtregHhM,`XFu@%%IXLf1%l*"p@=F9%N,<e(fs6dT-lJ)r\/m<6M* ,dY.t@($BQD4A8e(&K^^X(-:`=BX?aZ^+UM>>H]1R8l*[:jDm3[?MU<G>qLhjBHCS 1`AK/9E?JNYW%T1K2fo_2ZY*JrW0:12*NQlbg_m',^&CrT4Lun.@[user]oM[/user]/OsnZ(VG[[R Y`;VsKgm3<Fmn2cm=R@.YhOR,aOLH^`T!YGH)i:i%1oN2L-,bgBVHl8-2@1o(hL4> @[user]Y-P[/user])7Pn)(9<nDF-A0P3"!iHEQZ1_r2Od9VpH.,F$Rc4YDQ`,^#ZA/4aWi;#@[user]mrcg[/user] Z`sjgR"/>QqqbJLQC^R'A7Uf3R93RC4n&eSf8KSk[qkq!J][olHM7@=n(tngY1@oB %K4q]>';#6eQ#)(Ql^KJZ'>XEa9#k$lY_-NG2E/7mQ!][$#"+q/<mOg#ad$PIC.(; 8lTh@@[user]2u[/user]'IAW;fiJV<nAlYd*>QHd>t$T"T?bG@]EAVruh"7[.'#G!<j4)=RXOS=aW 4eBQYXkRi``,Jpcg?o^\GoP\%hHe"Hef!P1iZs7KBh8@[`.?M^IeQ$0$E@4gSuRCV (aL4Ld_R4lDFhP0]TEnLViV"$3PDut-BAqQ1==H@?E$et'U#CtAQZsO$jB4*MCmJR ,$c\d,:JMeD=??XAlVaQ6E5X]bWo0)/kIF@!9B?Z*1pq+rUmR<l?o"GHA<S5kY"s_ +8$eV`/ptu!#[(Or*K(<d(sR=EnYBgRWbV472s?@[user]n[/user]?.jep6lJFH_0o:m#_VKNRr(% i?=*#\6`Cn/*Wq(L3XHN@8JeXVBgZm,Qc<\hXX5PO\!m@V-QiZVh,14pXY?W=TJI% ?W$h'Cq>H&!+Tq^hgY9^Uu#4qpACD?TdHM-=f-p1QV5h%A!"_L`e[6oZS3Lk*L-n> dV)*hSATM\)4\r0.P*^P7oq32'h_Q%82R*`W_-\"<>n]"do,o;CA+bfNQO]#FgZWU AjLCTUK*;J)Pg3Ri(1pEb8G=TN/iPB*o_3GXP4c.g\%l-F!=dZZG;RY9eGF-m]fp; @[user]tr]-[[/user]>*g5$OjLrhD[Koh5sEnrU'9drGl<icb+*93hg>&i0i1hb:H=aej%%mC?oFV JrP9.D8QC/T5`n+0[qi%/S/]gYUX?G0gR*RKW,d9Z,H(K0d0McHPAX?hn>_i)ufmG N0r$kM6f(tOOVq5nuQAM7(!*dg`?g>-?O,G'C5$C[AD..pib$+1BCFI@7TiLRNaEW SWnNu4PmRGQ^;Q<Z[:K0G3a<g&[fQAP'K:L<mVt'm\Zk/.sRnRPr`Rbl'L;@[user]\7G-Y[/user] ip13MW)=sratir^#1g9V^UVY>92QnP%!'ZEI[Fj0Br+&[+p*#eJTLf3f090")fFF" c/YkZFVNm$6Wa9V;KtAC-mAGFTC[S<>5nSa,]2oH*otA#N>-LI7OEG*Nhm=5=^tRe ^sMWsV5.BL)kLp^JP`64BA@<4'4"fZiZoq68IVY#XT:.J,qD>Te"SI$pD9#RWqoH! @[user]c[/user]$.X^PY#tHT/=eChF?u<Ff[%E4!#c#[):`e3Gl8RHk*l_('=/#Ps$<rr@<<12:Es Qc!*%>>$T1g*T0$\k1kn;ahX>2E!M%`ruA]>6.dWQ-N=K1ZMZ5>$j+KBXI91D^'/E Vb5*e;R%4rL'.K$F2S;o4Dj?oQbsL0(KmHP^7X`,HP/Qp*mC7^j19a&AfpnRD>sV7 `Q!6A2_O^?m@=hgR4;u_;!CDCTZRi&da$.S@>p:7PH%,;U,GilVjkrE`T0.p%D5In YI2;8+KtVU"do*8O#CG]%O\3QgJ-F9jk\DB?-@[user]H[/user]*[bH!&DLB/i/oG#gO7E2%@[user]Yo[/user]'P 9d:9=ECR,^P&qo]H?e*m[695LURV!UD:>m;PVHr75"?TOUu,10P,*[?oHTE+&'/It ]nMaL>,#=fj<OZAfR9uRk$dUPr&Zg'rp;Gsf3S<qHP8$.`hf7nat-X!F(.T:2u8I2 7jF(0msas>_;"Ua/t/:N6niAbOrEQL-.?q]L$>S&p9E*/rhEO2,*"$*O3UV)FuH%, JVckSXH?$R/JQU?RQ1?jfnGhbF=`BP8?XqB`kb$ug:Ttp!;/nrVh17lSQ1\`X?e[" (d1Ms\*aJKF*,jbEq]BG\6QnJ8$t)-=ksqEJC;JTIg)qE`.W[3`>ch.QW">d:d<jN k"iH5dWq'aod5GPrr@YZO89st2W6hDFJW1;G$:mm@\.hJA<C\3.9(iF8thK6E"818 >H92*If8`lrTq.iO%hh:n)"$3hYlp"rU8QhYC$#YHhY:%pV2(L^NJtXn)"$3hZ!TU f&,NF^&-^#qlb/6rrDf^IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S* msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_ p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*a hnAojFmjeRmsb#MR8I,CPn=_:1D$RdU?p+D_,W`GP!B"PqZ85jQa-:+1cj6,idsGg !pUht*M&.5[AV)=W(6K)l'5e%]NRps4-?]&(%Q3i^FkI]/-^GT^8Q/2RRgO_8]m0l *q_8iR[0C&Ui?JKLnVZ3`K/'X,).7a@q.(\O>Y?GfQed+_c'Y;!hq0aW/;b-EO%jY \,;M/U!morSW1:W2\Q;1GugLF6rd1!nDR&0]NUqKpGd>pX8PE<pD'<G]`a&ONS;@[user]m[/user] 9qoIZp7"d0^n&X@8P>P<(:Juu]3GkpGTOilTBfX,)fnFW@?R*oi<iY(I$hJp;(EFs '_5NpY0!'bSdRHT+VRlkED>G7cGeGh?1XCfD#b,F`MQnC;H:Cg3g0EI)lSpo9/(sg >VrSmb](TZZ&cNWI:5#DgJ5K8TjajT2rE/b%9$P5l5"]G\X,mVU0SlWiDC=uM.;,c j$seON=n5$;E33(&O6\ZJ1@RM^f=22"+UQgQMLe;g$VttNR*_op'FYsMEf`CJc<R? P4i(Z#Oq0+]3R_Xd)s9?_H57-.l$ul`@=Ll5+n/@$NR)jHcGQF?;7k3=,H^'q=/%" oB:ha&bP8@H_N?#g2k9f-)YK);Fnb3BV]TAVhG+-`Hk2TK\u9:S\t@i)C(.TMb*'1 WSde"Jsr)C(h&:ZZ6XEZLkpoP<D^-.*mu&Q8F@LaDp%5'"9(T^Wrr=)"5$=)dSrj1 9#]kRM_cHS,i@76eb+P6g=mC=ZQ_U!^r7NC&6:?I>s1$g8.J7JlJ/rNFf)+VYJHLu msb#jD9:]G8O&8E?Dl)^gItgujp<t2F#X&6Ddg:jcA26WTD+K7;!pAVVVbO0@F*b( rr?76qqpGd?PpG<O6Z!pgT^BU2I`<NLB`iV[CNSZ3*#i<MLo]\(El<.j:A42rRret l>TJ7cr$hC!._G9DttiLoDO0:\UA62XkjdM]Tn5?^9##()QG)S<*0\60W9"+Jh4$4 EH/n(i%]+?-F]kM(Ja_fQ]?BZQu[YL;DZ)ibWe$MjRmNkBS&&1-HmYul24#8rrC&5 HGM%IAj4-#[rI&Y?$hh`i#Be?9q2t+fVg=n0nm`HTn?0&*54PTceQ#C'q&R,hN&fe 8<",(gi8*i!=G\oNAWSJ[oL,o!Zph"(Nj9(2]cS?e+4fVa4HK&Mk:n9bhMT*Ar&Vj #0P_(#*aiLZIZE1-7$*4;">r&AlWg/OuWeB8f[rGk:im]<R`ZG8L4N>!*2\Q#Q:sl quP.:^U"aFhVuo,pG>il!0cTBVjc]%T.DDb,_/HIYBpZW!)IXK`_<3HPjqd(IaDbX R-QeAPp_;8UGYW<8Po8ZMB,LT#j?L.<p\Xr=JYF4@K,fs!#kQ4I@5#9mVDE]XN2s9 Q,R5g.dTeaX_eI]$I$IgZ!es%19"`$@[user]J[/user]'7sI?qS)\*R8J7EMaM!!))GUW364qN=YN jI^$_flkJ,Ea>Oe*hY;krEo`OGkbuV<V2AAUS`/b%E5^sVm@'':!?(mgC-U4O)'EQ o,=BXF7u!Up)]mQB&YDVqmX'eHjdZ:ggZ,QM7:.QB51>=TeBk%K^g.QVeW9W]QU;! 1W^tjDB^8RB6S+5'gtJpZSNO(:^JCt"jaGPjBASW(/Ia(GF&/1hQQ[Gca9$8inH-@ *IgHk\u+W+f2O.,F])Z0LFZO77Rg8KPV_TI?t1"%FP+2!Xa%#+flpA6.V?0Qki@*b ZmPeQge!4;a[lSA-^@[user]7PBk[/user]'nKN[Y3nHCGC6Kl7qqg1fA"L']2nmDGQkgUR![W]K3V a%8h(Br`]hoYhZR&>5+rP=\m*Op_sn8aWXd=]o'T?KkfL<cYKBcoV0_2A+.ZUHC*t WVr3Dbs*u+>-411?aj7W$B<@++/O\k!(%_;I<(Q&'O^q@TV8,c99iBNH$5i!F,oRr mLLZkEkAODh9+H@T&`1QDHGNZ6UrK^FB".c2c9@4D&+VE1pY^"N-=\+E,4<$_\O-m 1U.<+W$RkdJYWcI\J>/X=F`R)<@[user]iTPncafuP[/user]&(k'jcAGSm*t^Rb/JMr"C6esU57o. "\.=ae,Xs:mA_*$aIDL#4YKM;&+V>"EVGnj/<7HuYIF&J<Ebi3R2&2[1-JUDlZ3Lo pdfOQ.KHrZUgtPQ@NbRB^O&7lG;]';[o8a;.ob!V:]Li[4I$Ta?TJOW9i"*9>ikpr Q*sE%@[user]G7J2fkp3aUF\]sBc[/user]3@2mUfi,C$oVZ-^9.^XiNq!$DCt=0lV59<TP`Og1&rd lCK*/VJCJHfQag;(+f#^.V3l7Ak>6`htq_&'q68M\Lt%bHJ5rfW<k.5XQ5t%Un;G* `8B6"n!BWKWb4!j@2*7C.[T&oHO`9<qqoa]p[<S*msau"UV=G1hYlp"^i&$/!/ljZ rh-8UlZi-%`CZVQYAlE]I)'MHTq5s@RL_2R;lrbqOuNZ="O"`@[user][O[/user]+8:2>*4CQgO8: \DdGfl3a<c[uY!!_Z'Us7go=s/1:Gtgrb[f9<!:[>1hpka!aU*7O_;!EWPiu7oRB/ <-jQIJcY0TFpfP)qr-t.MV[+@[user]4kD[/user]:\.=5JZ>M`OFIoc2H>KW`VQ7&H+2+OO#'p4nZ GQ.Ynn:/::rrB3.bnfiCXfgn0WCe6OaI%@[user]-]eceIU[/user]+r(Y>p27_V$>/CCWU%CFVRq- YQ"S'i;We0c2RcK]p]u';(XFmF[Y`2,a%(:?!0mX/"F_R@,3I'b3hms0j3l(ptT.b pa0_]C$C.$kud)4.$7o%T+nCPaV"g./7pTs%QH&@[user]L[/user]"iVWLJliM>r#GUhJ0#+MlDqk ,=>j4E26?o!u0;3Ya_qAJ>/=<"u[u0<([)M@>oMHWaous<CbIUQ8Xrj,FjD-QipB2 `pNaS8hcP$?QhiLqe9?=eWa`!@[user]S\R[/user]=0XAC;W?KY:WKLj0h2kq0&RTA[^p*u9m>MC7 .QBT;.`A>tBZUW/]gG)G<<74sA)$=IjmR/lq,?':)lGO!pq3`RH`XR1c#mddHokOM Y@O&<'';#r/Uj'RioFE_o/k5AMkC_qj)DQrbDX:+%&r"VgkA"iP9gnT]"p4n;loO^ ^f*TWg0f6)%i$g]At9&2/;Ru8hA[u?i5oFdDC#5^Gp\D@3o'[R'cC-uCBoPC)+)e; m"it`7ia])1*am[3em?/ZI$RUV)dft<L==R2!?NcB-C>!MEfos/p,Uq%2C1"jAZ^0 U7Og2GUB;TlJ39a5g(AkbF$5`!j%*4-<f+,diCmUF49oa5B5,S725]P*NQ[t=fM,n 1p7m*'ro>g@_Q>$,+b@l5q%VFB1$c^,U_n"Z+nspliqXhq42`>P*K)-ejZ:/$"<c> f\c:K?^ppGjZ@/=h$_;t^7*m@5Xe2"XuOqXii489#K_R[O9cYNiA\BnUQBj2.:e.A XkqNA\WSj!haVJO05$5'UB*B]NYrNCi^!*)eOF+\?K0`TgQ*XE7_Vri=eo[VM*Ir& DGR\sku%C]>lOf?DdYfd#s[c>pEXYjZu2^G$!%:_#kuJQdboW"\<$QQ&i]^4n*J'] r)>X\4U+(eeI4;)RE/2C>,Of(M-kd+4GCOO.\T[b;un(`j'g*tr1tsCY/6?:MK3QY lD`fX@!,sr-X)45#eY!;:6o9i@bUYL*,cnpatb`Q,;gGmWCRGnQ^G*a&:IV-oC"6B >B!>s'\h@bd5WX#/iJSBkeO7%Ui8S1,^r8G`no)HKl7anmdM*[i(hR*g]QjTCFB)" j'(H;e"KE/\BE($o()[%]<9s:d+_5PlacS5gO1U+)c]7"quIXnMDE34r'>*jS;tdk V!6.5J_@P(,E"&n2NdS'3WdPi<bN*2k*<<SP%kB)#Ne"33/=@[user]g[/user]!4fi>bNA#hE4L60 Y)]q<B\#Ij"_9m?8Pp-B@sI)8(/d"Xo#0.?7oEfC8$$E=o+D!&GWUC"\>GE;Ul)o9 Kn6.j.3hoS7VBe5ls0sfaMlL!NR+i1FnXE".6I'AL'4ejWDW<f!,*er7`:5;fSf?2 ?p08#;3[B=0iNsA-D%r>k#B)'<D-p6T`$a`AQR@(BSuNi/YBE9)>=UjL9"Fs;pms0 dA]'S\>krHA5ER)GcB7>r2E/l%7CBfh<Wj6hT/3NMRKsjVBhEO=aUM]'-W?n,">k* ,7qW"!%-bJ4j;aZ3h(6-$[KJ7^6CUTWR9crNU0gTis_cZ/-@[user]E[/user]%f+VmK(c.p-2Xe'R !*H#26JkK1h@u/uCon]=?9]8ZSR`#u+^d/-8H@1n0SA,oHlgMfEeV@rqs)p\(Y2f/ f"j1%HX(b1pV4>9\.A5s?L6ImOZ]?^knItY/(Ic`VM[OU;7JNT9)0^8_H(4r!O4?> nKB51QTg\'JCUaT4\jAQ(:qF8+3@)K6(*=o,UE7(l_=:F(&XqkC:$t8^a&S9.40rb lMUN8qb!?W]%U;r*?O1bAp4r6gk?1o':K1]Lb^g59/MV2<6\>eM[YWNT=\&2g=[<n !";UEF60FdlY?t]cVlBZ<T5YgEAW[!<=jqE]Fn@q8E*02eq)FX:9((TP'U;WBO2Q) g*HQ-V^c-EK`WtMO%<8I'I^DZBs>"YY\q)[cV[S/&jU2G1,O,n1utZmP#W5gW%/fY !H18%Y0*2`Y[n%Lb29]508l,t5YDm2j;A&L_<L&rBdL7h(%B=l>ENiLBmUM:i@5V4 2b[t<>KI%s.AEmUhUdcij,9+2BdJLQh"#\tb^0c!1>Qd$Q(@[user]M79Sf8g8c8Hg6Sd[/user]/C <OKJ)f,t1CSbK_MI%+rA&%Ofdbe0t[r(CU@Fn@8,["I+)D=1);8d'$`=9Z+GlU8h$ B4TL^Y3bK]n^Wk'4#Q8tgL?HZiKZCLL5K_#&r7HsTcQE6N@LkYTFD'(W?/l*?/_"& NK2$@[user]A[/user]>cD1*45u?RTcu7-4//hA(@[user]E[/user]:Nd?+f,\:+(AVdk-+\.:Oc2Rb`!c>\LMVN<5 GqFZo;ekAuCWBuC)cnSD=;6LUIX&C=,X'5tAahRsLN29&Z.5cT4;G5%@[user]]P[/user]/mOKq?Z *(n;j*>4`M8H:eRO&-n'26gY).l%cC`C3KY9;isK&B<%i8`Na2&V&N%HNWsSbIR@Y G&o3`l:O$16q\i_3,0e,74Ld/WE(K^KZ4/kUTAJhX\4"Hmei;P/V.2jTk6"0;U@t) HIX=_;C'Z"(BNP#8EI*"=^&apIpmP,j(i[X=X`KTPuq05Jt:QC7'cd6)'iEI];""+ ,=sgQOP8Le^<p[=ff,CUEGIdpCn>92)5'CeHrZt7ndT2?O.f,J!n^\0^>X"YmN1S= BsZOIahDU9aE'eaheR4G$sTj`bIJPuem$hpm%jJWgQL^Va-d`;Z7KP!_-(j7)/:/J kE<-,+HB/khE+hZJ&hECmp=Nd*d4tJ1S*<JQT#7NA%#\SplmJRTqZA2AO(kfA6)Te Yeq2tnUkFWLnL.Fi]b5\mK0D?R[5G*obdUt%!@[user]dl[/user]"<UT@3[6/)8RZN_1G-n/@s,?1 8JQP!CK9e[?2GX#r5e6WkV62NWlf'+26;Ql9_B-^ZIU:d2"@[user]SB4[/user]/\%AOgS4JJ=nXj AA+>4eAoTsSYO8)088s2`^rj:8MsJQ">c#_'m>Sp]*ho.?-ANt`5LClNA#/=OZ3:? =,s&>l2<`-28@dIrrA[h[`\T]QSS)&RG?I6p4lJ#rN.V71m"]!:^q.s'N9E<(*9*M dVRB8D0O0Dqiij'iQ3(%`<G\?'pl:)m?'+G7a#`l]a2<pgGtUlq,V?mf91>.9ulQN Y:Qk1pJ+g+eoKNj4BVfQ]A:`QBe:Cc&`LQ0b<g=#oYJ.d=$'?LWAs/Ag6ro4@S"T@ .^bK@38b=grr=-Lp>X:hS#`C1a95WPisAj>5IT"j;AE03,tKOB6I;bofX!mi2g/dW `E-@[user]4KpH[/user]"MJ?hc-D+s^s>tij/-iC4$TCBAj!-n7)+4kped\lWkoiu3.obGMWkc(?b g-^R.?DR`^PlZh[X)HABQ#>0p^12*@[user]Z4`YO4XaIfO[/user]'M>Fo[CPp%<Fl)DoM,=p>(e` b>5]*4,U#1SZ>1?j3pS4V$duO;"(N.XK5ii@X-Of)3>IggY:j,'2O5";W=YsBcs2a KR)6S<\mN'7"pLDCWqsUO:YQ23?mNFY2?cPVITB2d%dM1?R*L02.`@(i[;u58?AbS nQ:o9VIM;)`s/E"3_O_#/oGl![HW_"5rb058;]BC9`?MdNo/O?@[user]o-[/user],+`<34LL7j0D ^=fqhPED[(T+^mcCuj=iDm6N=G72[=RUb'?_WU.MU(k6h/aVngc(YL+HYH01.mb,7 J)R0(gA=Bee&86ai5MbJPYe=3)B+J&R4/kPd]4[B*CPd:q?'se&%=a!QYc'LQ/*=Q 93572'N!bf>R*+7Eb]>,A5WQ+`sP*XCfsW5;f,ohFR9OZZ_H/8G@PIRX(nndH7I## lEW0220A:mOK-FPaZPgW;aO,Wf$7c-i'<Bkj7O->^t.#iRI/n"Ut_A^RHnl.Kuf4f Nh-M";Y:b^&fr6oVi2FX7_(WO*-+[AUPc@r'_/gl`uNIIV'Lpt=,k`.<RH@u;u$P. m&od!!Oapl_\u2T"Ou*C&./;p@:r]oS*5`;k^].iPsZ1%8C&@+cIRO!mGF1j[kCI2 .?&d!obujdhEZQB:DkA3"p'61^G0i_N;M#N[6qq_.ASUq44Hsm,-b`o,UB"T!"11W JaE,s&f>Pa[nHD*'&-";_\=kaB%#(dIO*b^AcS)1KSEN9WguQWr*8YoLFV]'^!A3' Yt8B<>($V<ICS\3]Z&mHG5_KLgD]l2MH5]aI9VlI;d71f'(s[*<d48rQ?o!<%5djj RGjHdU'PD/St1]B.A2eE3DkP8?!&2iqH+i]f"jeb="f2^:rW/Cq-"\FEuc73Q=d$[ :8:T"6HG960gBTM)4969eMg7]2Vj^DD\`/7(Rg6g*)MIHI8fS!<`bQ)Io3%rM#%+" ?GYI\97iq_pic"h'&uD$0j/7go1\`eiaui-!*fm]Wi-#Nca,m5B8&u$.5X;sD?D=j '9llnQk4A$7>SXr]n63ZL;m&"nT?hhD%-k1A?\\UFO3q](#^ntaKVBF/7Tu!"/h4d e8@/oKi"d#WWK+@[user]5QJ[/user]"jrF*aNUUNJIbDcH$[@[user]mO[/user]"ge*W<I(_&-nRf&<W]\KC"#*bS *.Vd#B[d8%XUe<j]TuUM*o$93[oW4o>h\T7]Jg?0D(IFMgGWYq7RHW\AK&3:Uok4p (O,88D7.#&qcJMNeN,0\0;q=1(/T\:#-_kV@=EIp*bDWZWpD#71mkjX3ncWl=mFpr +dSiOTd1o-JUG%8/P9AK-.jXIfFd0*9-WiYMKmNH3*8ZhYL*pq8uVai!!!-"De4_H nol1:4@fCUc0_E<D:I?CH?h;8k/?:p.UgA-;<3H\W[*eS;dEAM3lrlS.&M\U+tCVZ eG1**YD6NGZ29RuR`)4(;c8%ih9e%',.kri1b_QrcI+I'aXCk#gdY:05RsW>?"s<= *fUF&\$#`2gr[75ICm)YQa,s?N%n)t^h(-d2X3hdUkRikN.2(gjdJO_22N0SDNSrM ,4`_9-1YC$HaR'`mYbSu]Ad_W7]j4th4/YTG#9j]#2iY</5Y$?A0_qfc7o\p6STp[ ?u7AEk?$\f:AgSfeCuu'^+XA@p`<$raONj^r(ec1a](VUSu%+jbDW-L*Z3msL2Bd0 /<<YdCh3C^K<[+7]5:In$BkinR#<2DR\mBnT!isX21@TDZA(u>B9o-&l70a&0Zc&H AVN*s,@[user]Me[/user]>cG$H+IPpJZ;:m*pDK8!#rrAF=,Q@`Yp/T[66:s<g5>hdmfHJq;SugKq g;chU+@[user]qMYU11E[/user](/O0a[-D3X:#b<#*\.Y2r37<I>UUP1VH[?\8'f8H-&YZ;*$9XSR )For\J(.P&+s\FiUXG(m,aV6K:h/@m.Z(?B1I7K(^P\Un$Z#bBc(nQm#dq1OZVUoM &4$G(&]c*n#X=E!X5>/u*Ns+_K<crbH]*Kcn`S:%C3.A$G`ALV5Z46UUej;CAbYkq T0:?Z%F"cFrmeNpZL$m3fDDIZ(H\F!%AG^J#38oRDB:Z6/?(Fh=f'WOhDKf&G>2l# 09N:b_Eb)9]?_T3,5jN2ap#j+N^3;Q2ha^/TWrT#@[user]g[/user],Y(;n.N<-Sq#9XYjEP5W(<4 @[user]B[/user];`#(DO+1d)2P?9GuKV@I#/YDEKgDTUuZ'>8LEsk5HiFWd3B\WP4$Di;We-p,7;_ P%clRHTPt3Q'sT9;R-mW.`9\6JdRT1,Fb=/[]J%,O"l]pUoU>HVc5GX4GXBa1Ia]& $h3[W)blk@:DP:qO)2EA'j$1FFHi';)J[#E>dHc@XNFkD5oubZl#qbj@ASe.7I8`` [>2MD%ZAG_S(Q;r]^acRQ6fioOXPgm6GJ@YmAVLgU5$!)o'Y<2a)0'B*f\J"C:r8C U-u%F^#d4u`k-upr+RIc2I7E/nNo_dc,u8[l;=^n\[";kQ<Z'*TV9P=l;CaC>.SCD P)<t9UIqO8o_I`$@[user]O4Xk[/user]:F's_Be35F<#HU3CgTWur%.A*(/s\-osI=2,a-\\$-bOn ,J!s+MZF0D!hin-8[$f_"G-pUK5p:qUFTVK!`MfT]I5>0=HG_=5^o>$AY4>ff7-i/ .g;nUX?!1gUkP=Kn`CT1JPlW>8^n+%l3QG&l\F43lr8F*,"hd'kK."oX@8S\VP3gJ _o]!t&LPU.AQ0dXHJ\)*G4PY5R>Ff@!)_BErPHSO17lFrmDRE>Rg`0)7$hbDbG2J@ #n=V6Af\hk,j;Coa&)tn+qXI;C9YA6O*9upmGkdfYif<.Cjr%%Z!'$)kIl-3gVWWD 4/l7/ibOXi3/($slPu(gbJH//2\$/`dO[D#a^LYR.u;>:P$+bY%#uW8LoOG\R=qO/ O:J[0\0gNgVUaq$X.]j2[qqn=bO-@[user]WCK4MEPFL0[/user]*<2+:ag;P>V]N"F/Ot?`*RS`T9 :YP_amAtg&q7"-515jeqnib[<#:$4)rTQMCrrA\dhm>T=g=XWX*kHKiL+J$)1t>R5 0LW1icNJ)4JjP>'Yt>\MV8Hst*\\FO)YG[mOlku.[5Wi@*7HZMO#8KXLtmpCM!(1E C\ihGrl891r*-6%!9solrj58`^NEWUI..(8C:_1VgIq!^>gcEkgY=SH8K8"q&9:u@ ?s8F_6ACJ%/SH&u%%>e?[ei4ghCiZR4hBK#42'5-k2-)AB\!i=Oh=`kV@eLp8G;ea 5k6T]nS!oLXCr?TFS7%3Yc+QNEnD@K-<;O*Rh_9`UOnZ>-]&5-2,)@[user]dY[/user]?+:T:CBHc j]G1OT[>6DpP5VcOmWPMScYTJO@urqEq'NEa'FS+TT0mM4:ep)X$T(^ArlF6!U<Tu Lku'2<^5GY4cfUC)h6o9h-]r<2[B?FiI.*^IeW;[p(-I6\cFQ#rr?h=<DW8W9d1,@ K+[Mn\#mXL!#N;7rC'BZ!(.iE^A[NWrU8VAf=L^kHhY:%pV2(L^O,]]le_U/hYlpC fAGWG^&-^#qlb/6rrDf^IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S* msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_ p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qq+'E pT6:F,Aq#^.n'Q^iQPn6Asm%_>YRjb[*d&ROqDf$j&!=h#.7Ac`[fY>2.[e.,#h3- eM'W%WIW]9%#@[user]j[/user](&`V*&\sn9^+G8"E\N5W]0BC::>Nou29U>P3pPqo(Md"]pl[B@& 7bXQ$mPcSc?6VS%,_`$4l2@r34ClHF;&g<%2);B:9Nge*52^<:<r5*-D:Xm)hM+,: rRU!LRsd&r#Af5tk1]28o`HMrc+Jlg^tob<`9u'omqs!-H:j([>'fK/Z';Q:X&Y7I )Od&X+o9:Z$92cM-Bh0@,]Od6<G"ZNkn]gek)Enm)DbNdI8h7?0E")KbRWI]SMsE+ 8tEl42`,Yt.N\jT0lSC4cEPPl93BVKj%[14Ci?@[user]NdcH[/user];@[user]h1[/user]('NM]\#%LnTW1R,dal =lgcASp1&4jH`FJ9jdr.LoVGg/"cZ,ft[-grrCW!=8r9!IA_SB*Z+g!Gu+/+TD_RS hrp+/rr>,CVu(d9rhoJ(8GQFjH"GcTBdAh!40kV;1E)EJ[&G>C'XYLHm_[Zc.kX]m o%)7?,_Fn0#qi!-(h6CA*,*"#'i@p1!$+bWFro&c)f@gDf6*!&9V:F7(8T%#<)q5d "LSn#<=LdG,Q@b[6E5a"2+Z+09>sT.=#8/c;Fr-m=dcq`gmam/5OZA<YkDWm\A'+M kH<\aofiQY!7lXKro3j'rrAY&I"0ZD&,uW4rN.ccY77uk-`=r.2"+3ORT=`[@[user]7[/user]=4F $3?DgQ7%aqr;l'?hSP<$`6Ul<UYI]aM!C9SV3+4E<Rc3]Z_*o]^p/^9oqmo8oT*H> f%F$7>,&$kT":YpeO#A'9cQ\<,O5aFF+:-nilBcQ\qZCr8Mq6)#uaJXka!U0M#)_) #\8'#1.[A,Mut:/!;f=kop4.?XS[:/ilAqK80l-:7j=!.;3EY6E#Cr<XAAt38a&OR Ei1[>JaMLb4Pq4;Zu]*THg=2,3p^[dD!./ZI"A'']Pe:,<bO*'AsQ!=i`AP!MObP% 4B5]RC)W'?ig(`F6&d-6.*H<5`1S*A#PuKrJnf"LLZRc&a&,8f.V)D"K!LP*2(YkZ b6.l.MdDq/ncuKSO,p>b*ZK,X#B45FeQL[J;"uf1e57eXL2Sil$e()]c,pTG,W3ih O(H?RQA1GD;JIZ@X2e7&,ulM*n]M:tm<'o"b&$Uk)^LP:X!DScWkpq=.8QDP;<4^E =XmiMF]3c(ecKM(l9iH9UgS\K`PD\dm``%?C^*M6jA_DDUo1!kfqb[I7ZJ3K3F])H <WhS+DT%($KX;[+,DMdm2U:Kc`^)CqH:jW.X(/iE)!baeb)]0$dhr3h)-Df`(q*5r eO*QOo+bJeC3-B^Gp/''*>9']T<j3V3@-q/;F`3e-&KE6X`tdYG=(8,`0P0]Q#0P0 JTb!NYled$D9%er^-*oG$;YS5rr@?AJUOdecR10`@[user]E`dq[[/user]=l0Y]<9HW\J2>;@"$`B D1+&.-Pj:N_tQL-P=uTaW]X0-pFMQ`MQ7]0Z!eRn\7jj'@[user]0tL6[/user].c`nie.N^`ZVa_Z Br"\QW:^P!.kht]db=^$$0qNjOKIdI!0aPa^_?M:3o[Tnf?2N6QnA,4JZ#MV/Og7* Ne]&WZP9[-.Y1GlRZmgk1JsTl&5`$tPdu%YCqdO9'e,C&H1ft[9YtJJnP[CnNflj( !DuUtbk3G*%mcL@AQu7?\rrZ=]"\=o3u'YOV$^"a0si@Gb`jf90Y]`2\To6#I2XD_ `UE73C>i^*`R<k@6LnUAet=E;N?(SUAE)[+-:l8<b8dh/85qdl5QCca!!9qG!!DEb quQ8a7$/BJ'jVh_*?@[user]KlUB7NuX9`BF87`o[/user]q#m=Jg#4XqHO5@ijr\gMdET!,O]F`T` LTiWqpX6S97%W0#8)'g+i^h7,qn)+@[user]oYs[/user]!hhBIHP)j<`1M;6/%4<d$!AD;qBpN3h/ gi2RsQeYf;-k/(IYRN?tTTElV/\OE5)EG[(3e%gBWi2oGD)0O.O.6h&=K5*!,>VB# ]1l!s,tfm;NBG0JX9U$GS4:cBQ89bK!hWplBQef9p8V5(@[user]h[/user](Pe#jLU*di(]g-r_7L !!!!_K%Au7=,sGM*ENtT<[A9U=9_i*_]u,`1,>#oU_(>'5p"DoH^K^?[cjFU.B:BW ZkX0XCIEpC8G[eH,c4\\[Bu8l&/%gmAQ;Y4'f>T+1+Y9SnN>8kk/rh+V3mn?CcDLX NIV.n4bo6og<s%\7r7=&YS4_C6E0]Y`E:rk<G>rO&KtAt0r[F\1ocNr,tYF`H!L`e pH<+hOW@]R;Gu!'l/cG7?TG%H@;lME,GDY>'`,MTFV`MIFSBeC!\7u\1J)E0>T:2r [^dT@/8];#,U47^;1M678f`Zd!2$]ZL>-+LjVP\g[`^Z(lV6dfhe6>%^.W.Y]rh8! c$L6!D,a'[l3OhVM<&(3(dT8VNOtLf4m1Am:Ep5mR2r=q(>6krL@W/%0h`F@R4YL- ;2RtBP*+d=iMhMKN",grX*+L5cTg>P,l[kHq=Z[REP"RoWi$TBlS_d9U-BB()cJ@b '3)&!Ga9,EV3WN&KpTb?=%&(D`>iZg`qK^BCt^ngB&VU'PbqLP4XMg(%P1CcX$b)X RC"s4Q8micDe+uT@$KuiFSTb@=*IY6aV30)I@d//WbZ-gSArV7PgDFBilXsK<;tXN 'XP@(%D>%RI=.>XFb0cAbuHWX=CG*QA+aFtLsk_P./)aq92@uP%4rh[e'gR63+7eg U*BO9+4TjaNS0\b@T\dj]:WTL\gnr)WQE^iX:PYHVN#)1:mYgX71]6$>G.(/FqM_# +]JnDH"jj-M`(+6XbnUJLl0VAgVQ0M&YLiejHAsu'XLa-okPUSjpjlA3Hj7Z\$t7? Y3'He0!9)hL=4e(hf=odp>mF,Gh(f^:pJd0l;sAsJRkTgDNqmUn08Q)7r.4N_*`mq =(4)Zao\$5^.JT][X*+8XE5<2QBFQ7=-Fg?*1D/7(Oaht3Loe4]pe7=7#e84:#)3G rCOd%=4k@AIAoqDLo&fe?3p)R%"(C5$>O#0N$,gU".!S/dQ=^HQ:>R6Ap,GSgG]AG F*2ppadT<Le+7i6@>8D?SkZ()J&o<rYa^\l=(NZ4S$+64IZcJGZ!rnA;,)q!=QjP@ 7e"MsrM4RJZ+TQ&m%OL_r?CUcq:pJc5:ca6e3;?rk`6,O!'<<@[user]qg[/user])';Vt]ZP7tpsC SXrdY]dNg[;u8G`ITO.C4I=fcWZoIl0ug7&&MM$A88VJ/N[CjObY(#R&kE7:\+edH m2k!1Q?a["DC:V8rr@#O]=OJOh!\i4QLb%62qXF!hLSWOEC1.,OB]U2&Ys0?lRJL> _&50Ql,uLR@ZcMb@)%KYVar+,l)^kU4EQf`5-$P%MM>5XQ+qf6JWkNNWnlWqP#n_b UC9O%JP`?Zrguc8>EA%Q^Xr;iDm4[S+TUs?m`4ldfH;ifdeJlN5IeHM5Nf3,+8%i# rrCW"DpieucTu]qaYDu-*<nbM5(iTDU)a+:5O6sCm:ujH;%,8$W$Ln'127_37#2k+ 0B'"Lj7%<e'YdLS9tYaVMZ%Iq.A$P>93T``CNFjZr-^0<X%`ktVh1EnE<J!_*.SD& O],*ZJ6Pah*!1BY9=[R!,]NbKT&sZ:r\r=6'i5*o1km<ueQPr!%NS-RPBlRje^!59 o5!!elZA$=pL2`c1'sdhQg07\-KT_*#bi=XKOD,L$NMSX4DFfq*M`W7@'b@$`')AK `7JLH?Zumsk)CZ]9$0asTolFlI6e,:M"Y:gli)X'W28A*^'e],C(h%S)YVRVa%&ds ennL?WoD_hSOkHpgc-k@I11?U*hIt@P)N25&aBNN&]*Ul,68P@dH#84:fr:apRC'R qqHQlP,bs\6V3E4(FYDNeC2A>Z4p-N`MT=L1pJ0eVbkemGs9Bu<Lm-\@[user]o[/user]?uGK9]=! 67]SgkuEefU#jM(6Nj^4D(XhRTk(Q^i/UsmE/llgRblk']St</Sut*WIJ_p8cGr3[ 9iQ+.2hEqrH$$+O(ZagjA,aO$+ks.pB,I)I>\:Z3E*fP`>2N[gN">,onao#`Y.Sg& cbko3.P"?Lg]Y^KWe(K&kR7(Eg`OkNMXIjIb"qb7/G<\]VaAC8Q)R=\QQZr7"@[user]j[/user]:[ bRo('R.=@[user]C59I1D`[/user]'O+LXj<H3LKd!!XVC8Vp=<,%.EFtf!@:;!jFUL+@[user]]R\sZK[/user]#N% gCj-0f!6QU8%5u?2&9b2$HC?pAZ.X>FQ<LC!HRW\o=!'7G;F<bf.FYIDZ+'.S9@s1 `mFJLL6l_>#E`T1L=M\jDCERY6Dof2Oi$i_J+G?)q.adG])dET3c4l6fp(;dofjP0 _P,dkj/1U2c)4+Z[+hcE$o+t`_[:LAo4DAtS*IOm_sFP,R3R-r](="^!$`I<OTjq; ZdR?;>MkH8c,hmlg5@J>le&G"J_U-S],qh'ZHj:F0Dm$*MA[eJ:=Sd8'fi1+SQ22s aK4LUWHfMAhP-SK\0e&ONFo)eNT$<R(KhuF9"MLo`"F[.,O,OW+(]Y8@I*VfI2\PW &JAH_`E!MM_Ae/LqH@!>iMhco3')qAVEdjG[LL3bBQl$5f[f=SN[:U&LbG3g;8Hco #V.+T,`TJiU`LO$F>):UDr$`gP7;\:,=TgeCBF\G6>!&[+kE4SOpE<b"odh7H?nC\ L?!)][H<I2ri]kG&)]7TZH2_p:+0UDR1`/<9+Ro3N[Y(+D*G8kM9*ClUe.CnJjj@Q ?u^GSJjH,5UgNL>TdiS-g^ludo6np=b0ad?1V-%\<oWCuS'VV?V4[%Y4@+ra>V7kZ $\ip(2(GN+a\RqoY%5Pd\1d(kl#6="H#T%51WFD0VO1kjOX4/hdJ">R.CY`J+D!Tq ZuSXOXGDA3i>jZ?IDnpkEH,$uV(*-P<RfX_Stn$<$h@bjr8]NVUcM5G7o]l-<sLQB (iurObtV=TFS/D0E=H.\U*Cg'7@p"na+*JAi1<bl>N5MM/0rJ;MU1DK-';1RYbQH> 7:=h\M5g-^k=Ik5e4QsU])&FmR^Sek>.A(@[user]VjRlb[/user]%&t<g:Z-m$#F/_0<WSG>!/G$u ZeDlsH+-=W[$+\+"XK*rL%L[kZ7$0Y^hAO5InU.t>-]a#PrXWT%r^?kq9m\CVjM=e en]]^)iIqD4,q83`CR1#G1*a[GgMb2r[*U>I]c2I/efR'*R-l?SB&U\E0,mLSV1-\ "=9NTOpe9l:ZU!Lrd'T'rc/2DLn6W$N>"H2a[HATC0;b_R]*1"MFBb8ne(LsOQ]S2 K1&\#=VobIK5^EH2]FR32l>u?X0&9jlR?S`K%*UrKH`[F;h#=9<g0T'-F#*FgrCPe iIVuLPm.mZ3M8pD0pN0h;+iYp_)r,lA99pGq$,Q<J7U4G&:iD;\rSG&V8cM1OQC/L Ngn'>"Z;E1Td#p,`-EWuKj!FPO>pr2k\ts+hSMCA;WHo)V8ZuCa+AF@H(t2Wd/Fe0 I*bWG%>Zbrn,Cg][lSE6X_%$5[pDh(Qfr-tr6_8ejD(9dGfB*g:YUs92`DjsndUK= =1Yls)V&D/,ML7N4HCF9eA3".67P\G<gDY';hI3A]6g`e=PIXrcQ^3>c!_5g>OV8j c*^^.hE_4!iKiaJT\!l:2,PpAgeB`ICt6YWXj:l"ln,Pt,'H].\$=Gm])$+d.je#W JgI:iaO1^QW00bTj'(LHb`taN`<7tdhSJ@i8Au[rX::&N+@"?=I>k]'V:M-69[m:@ ^LpP$%.n[a9:MVVYSnse23\i_kRXUKo2iWn2-@#HKKVc.l+ioKgCn+3_7?A]ikEiR N*,UM=cojhf_Uq1ff3:T1L-jk.Iu-Vb.<HK9"8VNBi/E?8-tPh%)l4XPlZ^f@N*W1 o%@[user]-0[/user]!#+`]-<[&"O^b,d@80\/ejsM6LW"3@?Voj;J#CN_EOW"A'TH1UID0-o=M,)% g>aV_"DoJg#qnG/W$"4o2;UYPg/d/WeA=%2,^WqS3uW`9>ol_@Z4o;)Oso@ZRRAQu (+gIT12BGnM.L@tO-3Usa&#->G0tFn4Hh(eQI8,?o#)f89Ykhpd77ImX;2)ClkYI` P$=Vlp71FqagGDXg230<rMK7!\6eQg=7]Tu9=I>8hEKg+p"HU10t27`cTF,T8N*Q% ]P=DX/[84(eG24@,b?:k-gE`,n-f1]hiIqBSppb;<:&Bk3NTL*b2F\6)d,<Rg]iqA RJ$?AqRNMaB`S"`3tJO"96G,(JUk[1J_?FPZ[aF,RCq(8:8!.hoaU20\RMMK,*,S4 `u:EIlY'15Cm@V_mTV8rWenZYQ2&CSnB.rq7k#no29+3XBPJYt7J1!2(>coWg,*FS N^jB.#07=^!!=p*6R\qCp:Ni=3++Cb4BulFp,;pBL^9a4"eboKWN^JB:)E,4,`a46 0OLT^W`cmDrI)i.Cq<5BoulGIC@g+h+N7>e7uEh?.V\-HZ:7]L1jYTZLlg"637Lo0 Rm"4F44_0,kJ/Y=_.aq<aX_'TX!?D(^l]cf][fR$:__NUNbM6uk?WuBQ/^mUh2unl MUqNEhsWH0D!W;7A!Uir/bXVMFh>E#5oKMUBWRpAR,sLj+GG,TCu0@:?VsTn>uLd% Q(n`JEV]tDoBjR[^,$_+%o&#,]2qWq=H_^BE+Go&b8\K!$uTt^.Z`7<7]+K_:_KRu O<[g!mOKkeC)=0hCJi/);-CA:L9F05=ZgiT$)@[user]r[/user]<?):IEEnW0rDu5#+f,\j1RHg;n h&4on''%3`7h$1Z64:b0"VNYEcAd"(k)s-dKp!12<*9\^52D=e=>p+bm7gH<W"6(q :Jk7GeWGUeI]@+Z5ftbFN.=^h+HG-u<,Bh#`kDah<:\CHi4&-U:<:FC;de`J,Dp"V M.6Z5>!Urh2mfIAg":/`Be(BP.i!.PFX^GUdQ^>r$FFlIq>i'%+LmEk\b;e7hVq&\ +l$RA/GD.MQ>[13U6\]rSQ;JbFUHU28g>`0&4nn>gC*nZDGT'`0((5b@cU0d.kRsj RZQqVI=uSk(=s1QAQ_jJg-_fjA\#@+G)]d<NR+j&m69%c%_(11:p=P1%9"lN)bHW] I-*c)1\T8tU\?0@+=ZDZ:fi40453s@I=Ji(fNXNCA>5^kDGqQWJ^2(K]Y]Q-__bA4 .3W5J>,Wl#,:!0j;ll*Ll7)ph(LZ^UNq^aj?WATj%X^ihAPddt?i#8\[D+oriA-m0 0aq1Ohb-eC,nX'fEUp1k)J$P"DIec0.\L.eFYLmH;So"r);(2`*Gm,iSiWkiLh`pM !2Qj/F[+f$b-:^t0Fju=PRp@!2;&<VC^j<M<<XWUooaS92(/>pgtgca'bE1+iDc"Z @[user]4Zh[/user],>tHbc%FI$gZ/t#BRMg_J/5.qD*.WLI5h@4&4fL0,Fc3,f.l-d?H\/4KUuWA] ?q9;,Zc^^;Imim$(Xr*G0C:=!HRru=2eaXtMSgI!X)Ptu%$LC)WU_edZp].\J%,"c \X0QI[El=j>>=X`Epd#AcXB#b)cDZ9QFhJ!DGqnu91@9'<]7Wba;MHF13u"Wl6tp] q\rH#/L>6bXXk+)`/m?ciJ5h.K#ilXaGRcoBm\-SXX1_.R=P;;@[user]S[/user]+'+%qZ=oeCuag H*R=VPZ73UZrL=R7&WO"JrF*_Lo2Yu_<hMO,\W-XmIDj(e([+b].'AQhR2j2`t_3: 8WE9AE6U_4<(SC\mZeNP&DQkG8Cd*+Q)Ju:r^s2G>=gFcZD*E,kok8FP"L5YE0;H3 .Hk`RXht;bJ-5In6AC,3b-dDQ!N_rWQC:rZ;*<ueGskiib,/a,JeCPN<K(4S5r(>6 [CH';nSdZ1@4l&i-u1;CWQ!Jt2.^gq8L6UV^l63t&2ME:`?!4S2Y)S#.TLSjWnFSa q!E8W^@[user]k[/user],MU:gXslE)4(+b3Y@UmcIhfqk_,Pc3f(gqHhOlb31Yq88LM/U+h`=-A'5 g#ff%`GS*+(4!$Nl=Gf0Wll?9SBDK[cPkRQE!nt+WemH+7-\>MnHK+4,mu#MZ1SYm a.Hk>a)0:agDcK#rTs1KFnr//OMp)Bl5a>0i_>NS<XL^Lm#aqD"XM7n1T?[bUSX#V [5"E]>K_-;k;*1BL7KcdL-T3I!!&sB!!2`l!!2l(\,6`bffQD_agu$:Ff[m-Jtj5> F=ubL4ZQ^")6(G9Y7hh.\KWgJBiPdd3G`R[#-#\pe'c)L:bkR!ao2ji0-nhm#nf<A _"Lqjc9bd5IS/9AW[JK`>&Uj(W!0,G@&-4RZ%@?mDHoY&.YW.`l6@q8l`=+o7B<JQ poSiRd7Gl53dPBXL5)52\!.u1d^tT+BTa^Uq<,?`+1O(ijXTT^U3U7#0baZhL`q^I _3-ebeSS>*5[rVTqba_,D#6ruYb#Wan6J5_Tm5(Md?,D,^q5+^-0:Nn&?(HrV^V9U QG(<4&!ZHhIB.5<Y!73d>`N'MF1/cN1l_sNHbIUKOun#&BZm2pp)A*!%iibUh"jE8 ,I_5r>-Bej-:1=a7\WXhB+&LE>5nS0nC)IXp$ILFR];XPd]T0FG'[8eM.TYH,SCnJ bFuUAZ?hCC!0dMuKG&!tp9.87eH9?^F03/8#Qa1]=tr=&U1)35CiH>SBkCC(ql6ZQ InE994Y,g/$CL03pUD_/]>#e_`5_$E0L^k6,RG2JIO,*al"WYS-uCH7l7?aoE$0K5 ]6T4Oi_o\3I&ogXPc%n"p#%hMER-k1CWq5?ZQDnA:&KJg<[OXWoWhK!1pYIfNT41# E=2MID]8kP>*b*_^:(V"-a4CEi&PYnRB8=)`'K(cEM8RkZB7XN'JjH"b]PWI!G_Z9 G1?4d>Eh'&?6_gTjbARD$d5Os!32E:>qEcLV?@[user]H[/user]&l4bLVch<mNboE"Yls"rlgdAVj (=C.=IEuV#HPVA8#p!ZL03P.ATS8sjVi!oSF\0dfW>/A&VuC9SDu@"]pS7)]&,6Xl o%?7a&kd_fT4@Tj?*TJmGdi-CEOs$j'X\hIZC\Lq@#W#1Wi(RUW4E9'k>lFsP$OX6 Q4+8PfG/DCqh&p#C")A35a2j7-Gnff"N(0=6$<Zda78WS@`>dH3%!T7.o^pV#$lC: ls---kPAE8L$V"DlmBY?d:0RCEet\3L,E^IJ@X)GbRFc.m&6pgJj9=kE*%/O]JT+H /C.6G:rOE>&h9s-k_cQ"WW7qIYV+(K-nI]8/3ToeRbDQ#MlUWIQ#7t4:Ck=.2iKcI h5p_uOt*V+3@ZQ,^E?bLHY4sIq[W;*b@*TZ[+SQNZ$g&+CNe:VLd+DokA,`3&R:0c 6icIS*0-?VGq)!<D3Dq;dcU9D&Z>\D7`[GY"Ks*H.O8f;c'Slm$gb.q1c9Mq[A:^^ L>2Z\]VD-cAu^6%6<mMk0\!\PP0PJ=MOlOZM%jsBW`@[user]^a[/user]'q*Qc+F`XM`)0/AGe/N, WuPmGBN-auW"1%N\g_^cd^E/hLX:B$4eICnLH*sdN;]>J;7qOG9$!b>bnGT+Bb_DW Du0.MUAd(Y,O@#<8XIHG@qqo4ZID_t3K@/JeZhS#76Ca5jcd]a[0SE.O>MZ53hL2V q?f?U/@8FLn^UQ3/Fc?A(E]K<M_[hYe<1tV7^FTH0C10kl8hG#UrI!/Ug7/i)ObfK cu';YGikoH$dP;?aSZ$EpMX\!mTXSl[R%CjP0%E$TN/J5=INfq/qqfR$freB.AF(I PJd\-1q_n@FQAI.h"f!Pm&`5FX-d3bGHP2Bp'nUk9/OC\4'U$OdG&-ka`2)OZUkFk CK@j/1Tf:[.G2I2?A_E4Wl$%k7!14:P)XD.A;p_kF6g3EDrY4/*:@[user]Dk_qUQ8N2-[/user]:% JY8p\jC"7.Rjh-'(l"A'8mRA)b9\ubN/E4!>.'Z><JGaZYkJ6f9Ot=9AMc9sg7b7H MP5/].M=`E=eh)gSiNQVQ6u`)h&TLGV2j4,Dn,r!A,!*SesP.8%SIZ\@[user]MFp0P-EM[/user]) ?&Y@'itjG,@[user]B[/user],RF'r<9WT#Mjs@Ap*&%b1*f3l`I6+bis\,cUlYgnQQ+'JbtDZN.e' aS$BJoqc/sM^Q+,FYp`59)t87.R+iLX/Lt^&hWh>hpgN>er.!QNu(NK_:R2q@],Ke 1;JuNbtqY(PK_QK+D,h*ja[JJ<'[^e5YF8Ch&_i:F8CZ)!5HrX'G2VtAp/#hZW;T- E3RG1Yth+^X*j(LcPCrLOrJ)CL>AD;O"bEpqk`]%Gh+ikU4o;qi.Y"N,a7)&;*!'\ QM#:@#Wsl^`?$s=#/s3=2u`k]hYlE":;7`^#0!^[5?f5nJ&(Zsrk?V#>skj\XZgO/ B#rGRF%_P4IB9T'a,6n@Q#`W3W*AVY0@s-C4f3FEC_IfnhqHN%6Usc3bul72<Dc_& <k##j;0I,(Y3V`5Pt9FL<CHqtS?=g,I('-OY/fcb(*4B/2+s".!<qrb[m&%1Ye$m9 0t"D&<Rk\:o@-`1d`j;26IIq7Q8YT?It.M!/-#YNm:V?qf43uVW6]!0FT)dZFOcN% !0+!&-8Rpr;TU,_3XoVOZ8$2i"+)i\DX9#mp=Sd#JWk#[n6K3(e&<IQ6/`moJXG*< 6@sl&\EF=f[k@8b/FsZ=hesGYXf",H^V)5]\(p]#O.]"Sh/4>#UGl&ka%bnK>1%4n SQka'JGfUQM4U%uKr@HK,sFg21,/d/Zr9ma0b*@[user]i[/user]'a09$2Wj&Pg[\5U(L^imq4:CT \MrR+$r4q0$"MSYh0YD7@<*b8',kViimZ7L5TC.A!98uajh;OKjm$S912e/@jDbEb S[1"[^@[user]P7[/user]&"dWo7-n1-DQ<$o38#`n2Em?NY*1-S-X8`1b$EO058aO+_Eu!M%!O-kW `?UC.&\Ys6W'#.AoY7^K=&(70.]H(J@]#`3F!?(/'1UB9?hU>HW.0UE_jl3Yd:4Y8 XeO)%WTrHmU3MA9Of_b+BmP%*<^nR]qLJe+ropds=ki>uXej7].5,0;$1OaQ5nV0? 0h#h0VHWM)<.K9pmN3qM*q@O'J]o&jJmR.$`S@q,K)KhoUs+mDAKcd3\WSZ;1b_Kn ZGoHAmXWo^!h9/l7K3>m*libj/H5_-S?sd"<i9Kr8>I5Od8H9L^J")B#l^;88,A^, "sAmT^pt$`/Z\FVnT"OPpE/G^`9b-,=lEbbcU5CTFsD%H%*5a7h[[$Y.\MrrU)&W] *E$F&=Cl`RN`V>`=Fq"$K^XBa#9?H77nb)+YFd*hGAk$jNYpk-`p/7c8E6uc!=B/2 qjm(9i%$R`M%gR)W*l\i5]p*-q.``S5jDadP"D=(=`*6-P"=,pg1H'#JV^:_8%4dt ):7</VNN]`(L`ncS^*Z[ferbo;Ld'6rZg/.YqLB"i?L*R8!K>j;_5*?<BN,-9&Z/& es+==g]M$,WIM%`L7\A4hYlp"ldO[:hnApE^&-^#qqo*aYBB;_p[<S*s3TZ`hnApE ^&,!UoD\gbmsb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5c qqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S* msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;] [C?"0rr?qdikG3bpV2(L^O,^iFmclPrho_*pZnI:J(pTDHhY:%pV2(L^NJtTC2`c> rnRD2n)"$3hYlp"rU8QhY%o;>qAkq%$H.G-++:fN8c%P2rrD!&a8PB%a7%m`n)"$3 hYl';pV2(L^O,^iHhY:%pKm0nAlEh]Vu!A8rrBMLnhfsJZV;YTkZs8I:V:$4n)"$3 hYlp!H`qe_&jCu0onaadp[<S*msb$"Id>g6WK5SsrrB;frH%p5qfD50IeW;[p[<S* m_.4uR!fj-q\/G:PP$4$!3U8/YC?67IeW;[p[5`H^&%H`E..W@^&-^#qqH:$-V]?7 fB'%P9f>1uHF^ek/2<L<T3KD^!?>hT/F9A;-Jn*FniB8ZQ['HG'h(bW&?;CKP"5S! Ss[+"\$EHP]XsUoHWs#e\[e;4$PXBG7afO<N,Z&B)DeuF"]B[.WK5T!rOM[RVB88l mE`M[nkjE\o_P3QLF<&\h!jOHQ!%7OJEdsaKStAr)lXs3!O]s4:OKj??DcTP,CW^s :2`VlRStpdpuBMB-)dNbWK*3[F&52R'7&M?Khl=Hg!9Q%:U+6.Us:8!>K&^FWp*R8 1ru=iZQ.-P`iPk=Wp:!:IqcUCg:c2$RJDbW[qcXm]C%a\eV(78VRJJ3M(GNI&]AC3 [`rH.7u*rjV4Q4JR+jI"hNqZNbeS[D:]&K8n&N-``*TmMa(=kkD>]Qi);6R/Cilep LG'8t71*:lV-f6d'MtU=77Aoh5sE],N-r.JNEm6u<T':na8?d8cbFi$^O&Uk9qdO% ,+N2Ab!qW=.\q/()<dfE.7299E?,]JkQ)R;-jp'n+(\L="3RZa1VjC#\RUE8FeC!X 0+oj:1`tF'.pUMn&%?9I4)5/bg%P;[f5XM,:LeUY*NIt:A4;^#^KW;*^_/En!\EKb as3YGeucNQrDR_.jSS[&IjG$oYp\F8e/N]r4LL!5QCTHtHAt&$-aC)TdbiN6&*K!p lSfji+'20&=dPe5]!A1?3a*l0NN4D)W0JN\25WiWrDL^m>bI&a!pl\SDdLLk,(VIS SW(P-`M:HAasmO+3gl.lE(*O'c)!91Z%>`)\`ZT`!VH(.junS2N:#p?ba2[>CtB+@ `j#kc>oFprjZugC)Fl[V*CJ]+Ha1//W?4)o\a3@D!Th#g4dmlOCWX$l2(UL%K5l/^ <iJ/3d?R1UcIm;uWtS=S'N:>dN&o'*"H>\sm-I'=W46;=O9N@rhFZG,(,8SU.hAX9 [iarCp:&],qAK0;BB#*Gj(@[user]X0^Q2[/user];:$tc2sE`,ggZ5#_E+<sb1T\TB/j4g2Gd*q%L ``ACk0cVoI9W4rk!!tXCHhY:%pV2%`of7+/&l7#@[user]rkH3ppV2[/user](L^O,^iHhUk4.b%4c VJ0-1B4:f?'CUiN,Q>/arr@[+5OW7B%t=9AIeW;[p[5`H^&-^#qqo*agKn)CM8<)Y bf2u9*DA,#.V2`+N2#DWO-qAYhajG4,X6uHpu(aC4,4VFR)ZM:6WrS/mkc[#Nj)JW 9[D^[#?5o$RPMYoN2,$?Y^>Wt&:IE1;/BbSM97N*b#R(`,U5m/.-F,HJ>A=TB\kY2 \t+\%.i-uqPO:$0Xjer4V1`m*"(&[.F#mK]Y&3/34DPluW2de-ZD@(>ka"[;!.qfn pS7288L+5DG5hPp0gG,>h[g+o!*f;`@[user]K[/user],ldI$i'tW1gD>>Z0&U0hPGt\47sc&d?:_ +<R;brgqrZqqo*agH?ErhsZ`?Tt7QZrr?aYJ%^3hn)"$3hYlp"rR\X%o1LGA,ImaR C1;\Lcb9CAoH\pf8GC`NHhY:%pV2(L?L,:!rD3<3n%DHfeCOX">l3RMhYlp"rU8VA f=LELIoH@%qsbs18O)O(IJ*'crU8VAn)"#p](`p2m[U=5TD"F<qq&PGrU8VAn)"$3 h0Z6J;c(?U1o,Ug,?t-8hCG)Pk5PG4k5PGKrUoX9rU8Uq1Y\Z,[V>a$2j:,4;Pg.B hd'5NXt<F@(j_&7(+)#o<;s='F7%D-[N(89(.+N^+KqT<Xaj#u3CG`$V"':O4NAR7 ?"eLa\t>n0Rbi1@/m9,nhFB<@[user]1F[/user]!1$FVSIX+=f4+YYo2u:5`T<2OX:iSXL#1`bjGT hE.d_[O\:e^9k>:ZpR",W]Npn'[-p$o-+K5[th"W;nYkRXN19rpYMeDC28=%IImOa rr>@[user]`8cJd[/user]<:\tZDlLC.(0gRZb0-#*H,gdB.?#drZOanR&<.jUG^O,^iHY9*+S,N)\ ^7(MJdc]LorU8VAn)"$3h0Z<J1&@&_f-L7ZhnApE^&-^#qqo!Z?MEo;p[<S*msb$" Id>g:hnApE^&J*4dGO!A^&-^#qlb/6rrDf^IeW;[p[<S*msaTYHf)O6hnApE^&-^# qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE ^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[ leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$" IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]u pKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE ]n*l;P,ZMB%`-,tlh;]J1mMggpul4d#uB\"(5_>,W`d&nR--#"I7F$CNYpiG='4I= *_@Vt'bW?$cKrT%Wh?[3^]:!<rrB27:$KB9-XbIL)EKkt(P>cndHZNWV$32ZOCND. P_"*8:A->a!^9qM@!fTPAHj0H%iQ"rX!Zj]n>mh-j%2h4djcN?'^?M/P4!bPf9^oi gSK/h+*+hX[Vc^E`FZ@9c*\>e!1WG0$n7BX<8(do;.c#5&ZZ-=YBtN1@I#`FHtEk> Fk1.TWMh8bXq]23Tp>"S,)YMc)W3/daNQnRL4BRQ&#hJ\ANi?;+f'P,f\$E0O)33: NPrK"/*6))rr=I51VhU6O*rX_oGKJn$!VpmYr941:"GG:>$.aB.Qj:HTWrbeBZO=0 +U!'uY(B.Oa]P,97@7?@[user]D[/user]+sR`Rr;cBE9RS8Po?AS4@<6liiIe/g+&>P:ll&S&aTT1 @[user]Gc9G^Z-83poG[/user](nXkV9m^IYuF5(+#ET`0id==YATAWE'O$"<31co[R^fhJME-`1H8 >\Ia-8qA.hJM)4'8+uT]M?!\rW=@#`"P]&$aiYCRR6DtXZF`JIa"g4&@[user]`n[/user]*#`M5?c 9ZI.7iH&=uY"=X<AH),rk9?W./ku((dOiY/@KT&qVVtaIm&cs!8<Oq2hDRnI:A.8f VN?MY3^Iqdeu.i)q=a]'W_l1fGg)a'W5p9`VQ57l'`plJYFZ0!4O_<G=^[DalXE$& m0[$E`BFr_j.]Z?2^JTL<>!56'Y+o0##:?]!*`@[user]Q_bgas[/user]!+%KR1kfr:/\89/m[ELU 7''pb$CNCnalN4iBrR%)oMC)c2C@DoV^'p%YGGOH[5U"bW&j2lj*f+&e8@a,'fKNa 4[bL950gSb@gWo;OI:YP`#8#mp[<S*)g.X`!oEnE2+0)n1pFJ>dCUP,l3K<BLY3u" J,%84.*qh@,cE$8rEg>C:c,BR*Dfu=87q_-Z`rk[UIc]3BRmENYZ+F_V4!,>&'6(- A;;[uK+H_%fh/*+l1+Y^C:TK1nkA9W@<.JR.N1gcPZ#X3&U"6:%9;-jFS6r<T'X\E JB(7Ia)-,:2$Sp>!JTk#Gp7djOmAO)-ZE9TH=4L)'VEVc;-f09C[9XHq^D0*6ejeB 4L.Sq=N,2q([=]j6F4.;;$*Ub"li\#04DD`ES+XSc*rs`>4\7ET'P0KdTADcHcp9' _TQkP8`O%Rhg3!@[user]cYg0HR[/user]:<RW/]I_J/97SXUljD;c#+j#<"1d(FlGkj9(/me<(qsr VOKA3=XXGQqMI],(q#8:%*Alal.sD%fGU5=2l`M7rr=W8j'L2]%l[(g]*E.bldhe& 4?de<+]072?>?HLVNE,Y;oP_(PKH.N,VFs[QW'p?JD6CTqQ7`+Y2$^KQ;*\]7S,)f _F"r:jJaTj3oGaq=X8_MlBMWiL%3<.P,(@c@>n]oc/G\bqg)MU18]D\i2<cTRVRoh nOG)m_#t@JgRkd&]_Yh[[ch>IiN`\A77O/#W*0_?aATmHVPlbC9-$u.J6lh`"L0V^ @<>Wm(*,-^Q2)>jmZqmj9$)Gnc%iElRS&k[l=?K<H!$E&6jiT$dReXRiL2-VPJDuC H-5j*[EH2KS!rbgf$u]V1^sTWWf"D'AhDZ5>:ZFsQnfmIodk.@[user]^DkZBq-i[B\m1[/user].H ,&_h]7G'8dh-o.5S^(r?UUIWJ&O`l+F"3Ym-b$Xt#5+/-iX8<r]bTY+Sc8[X9ZQu] M>mQl%K?Fb4lU!_3aG@?pg?Df!."8mDVh_;A#SS5m*4?%jarIqC>=53+NNSXTT!W# RVs2='_r$/:h61og.r>aUSjXu7u]U<W)Ipe?4L?QAdU#Fr)H1h2.BH,R]_BDb=Nt$ b9^CK&ZA&#6HJPk'a?nX3kU.M!f*t^US:-JC:]dHPk#%g1S?jl3'U:GYhum5[8tSh 5e+g5bN7lLRZ;#\ED$]GY?+c0\7Cb)r3/U&]!Po/&ia;ANS:gZ=Q&K7'KP""'\e[1 R&#?X;c/aZWMio7Xs#WDnXu7#N>th?aXkGD15@QrE=e_a@+o$`[QWAc\<>_"ib*kk .sP*AS#2(;<rts%MC;tB<63A/>SRk?-:$C8_VB#hf(7YQ9%g;TNW/ulg?l@e@GEf4 dVYmlfV#t,G5Gtpdr4%qpC5F=-<l;miO-.G/Y+2Nq+eHH4nm#B\'[eI!$@[user]m6[/user]!,d&U St_fK8Yq/AZc+)HL*,+Phh1kZq&ba>ZU#[>CgDb$YW;+8$-[$@"u;5j[$"37dns') +A/);FG^A:?.K<l'1j@5o.(YM7pnd>9TD<M92O5;eu8GQ,tp0G/8T34G6=F$fAl2b B<VKBHE.3:Ks09Y?9.MC4?Yfp!gIgB5ArY@i5nk`[$"!R1j%_IM<UT[]c&/Vc=Mr; _F]pikM`7jVF)s6gr;B<F[W19Q,amI)(MY.cS4t8GEu.4a@e<09Q0?cH[V(2>Me"> 8MkMD]rStlDRS"ub(u*]*G:fgN2roj.k%6/!EK5&0(XQL:!>]F/9?"c=m^E[<lo3n >4.jamlpWWml"5`2`@[user]KaD5Q[/user]$qh9+IF.BR,NZ]Z3^Ne8:^b6pjB^=&g[TaZmTlH1sb rjc81^d/qO62posDth"Uc?oL3jsY!0p>%S&IksM$eADtX'?`gJZ$td(Zu\@[user]8[/user];bS;D @!ZIG,3feCLjpmKls6ZP`8`b89an'[7S@Z..OubkhFcJkeB_%Z8L,+?SXSW%F)k&? ^gE2i`ij-N-UQ;DfiRY\jN!!>l``b^rX(fI]k%b5@;U]!L%3#a2=GggRUURAb8E/j j%1#rkLj_?.!LVq*)*uQWsL_R)Uj\C_2=koUkp@LcE]<5//8Zc(5C'(c7F_,5!oUf <sdV[mCXFkNTZ(k`^u/dH4!6KP]FrC9$o)B)'jS\cL-NsbgT*SqR_0(NHYa5ISSOt )fj\@<4\Z.W0UY?D(BD73[/fcAS-&S=?.e1WF&:PTfBg/gtd*gpQYDfIts0^hfYCR @[user]bPY5FBI2^X1_V[/user]%QFsYaF+8,=n(Vpq>20K&UpaC.VOYUg\X!M*>"/u:![ugocQGIC #`dg2Ia#90j/DM(5Lq"q4B'etkc8<->=g'je5&tKp&qFA!K?RXASlRpp&jH]'pr00 >kKrg'1J'fR470kQ:YVB_J-r\F6%p)%/sB$"aL+UhkU'<7jZ_,NM"kX)RDB;[ZSDU D4F#H$tWEge(%s5:Iu3sdSrk8K1DAD+jh7N,u%%C"LQKq`5I#^mZF89,HPmZQZmTY LoN)Obeu!2J4V#:#:016;dq].mBr^]FOC*gH![c<RkSi(oeaia=b9RNdJ.D6;@[user]l6[/user]= ]E_)t5ZS%j'i)lOh:-`(h7pHY-!k.3rn:5CR[/\:;$9lR^[UH/;b$$4d;Kt<A0i0d *lD28/M?X?/Za<,P*cW`G\M:OP!^1_2"7T.5nc`4,)"Q'88D-8'g5;5k^28A[X>Pm bSS"NF%!;$Bk\7co'9\g['SQVXfcQ9g35PoG?rYn$g;'-RBB8ugN?u%9Q=E2+TRbQ I=P)n&q@fk@kN,2BQ/&mFRnVb<EWI;J%;MQ<g&Fd0#BK)1/k_,$5P31ZYBR$a4P*u `O6F)/j&MEY)OX'R4;p8`tYLM"EOsKeQt#n-NpoX#uX`Tm.&1KECSC","E7pGEPHq N=ZJ`B4;TT%SIE7+.mPOne;rEBdbL1l]DHSH9.F.;&J0+RMTq=f[pfCZ2U?<k3'VM *n42R!n=`nRmVG*$'VBhV)bjgnXQ5')JZ6T-7P[Bed.OL*`O<FRaSc+#@[user]E[/user]+ehUHgC J$uPURghk59Q`*%R46gSQLVUDa!EjPb)F2*Z`+9tDbJ:IYjD+NZ>Pd_j(KT]G.>CO O=]!<>D8W\>-+Z6*\saX$iZ@?cX*mNK7;W>a5tTJZfE^X/kP1Qh(A@"ID(s+hTL#5 D:rk%F$A,lCii6WE\&4hl)2%N[nB3hj(bW2^!,Ut#/qDmp`TIsp@IK'#b7RaYSRE? E\Cr%#MG*\ohJ#)Ah*@[user]56[/user]#h,YQ``l&r_%92eRQ@SdaPI[ADi1l.a"$QXE6$^oeAcY Vt&!L1l`B,`RrPaD1:/4b6/F>0QfHtMNT\D9N9+TC3l;@[user]Q86f]9iDq[/user]&QC`>sFd>*K .]#e*?Z#I]CfLQ?YK>hgSCiOrXeqt*H]_m.6mgh)39J96Bta(AVRptY[SG__rXVej a3B^fjktg6>>7a!Z_Y;Q$`JSZ'M.(6*6h>C9BV9@]4B_.[3pu%2H+Tg>qOo*l)Q6Z P"FDoP!j%(3+f]ER)i?]0lLF+[ejCe**1O+gQPg!aLla?[C(@[user]\KI03F903oL3[/user].j>3 V%h)r$W=$&;uPaJ\]XXG!.<Na]]=<]pZ9Tu!8W")lc^=7*5/d=k-fHBmpianQM9"C MoBU]D<'EqRrt6Aal19'_+?I!rr@Gt3?.1[rTjFMhUVKnC/o0Mbsd2YQ"du'>*k\_ f>s2@PbI00G$Cmj.d2k7/ubY+2(36kT-^^&CC&7Fb&/6C-:nE.X/2i:BM#pkp`CRB dHUu1bD4L0''f.@[user]Ssl[FZ8[/user]"3_9GLBq"LQWJ4D49'`6>-2&(gFA5I*A?`bnPGh(aBi aM+&SC8e/m%$^Q;0dA2If@&t5jV_2N.G<TJUm`Z/nMiNjHSH;o_;b&_Vi<H2:t1kh e_uYAdmL25?5\C7Wl%kqfO!Fjh`6($E*;)PhBq3ihh0ilXC`h]VQUJ#b;BT&e27J/ 8?S)\J4mSVpOTmLFllFsht_0QPPO+#SUZ"QF'^3P"IAEtL[-Lp,DlLICEl3K9PkZ) lI'HPX2q.jKsdn['go>\&H*PBeGfNM7E<%^elho`pI@!R_Qn.C0i\Q1-n>]p,-@[user]]m[/user] b1+u6Rb_JPLk:i/P.m3+kCQ_),:fAYg@=3;E7t'jAB&KqFZ)j[)!Wf'_HpDXEF@$c 0TlWK__bnS05kbmpp2G#40kS//Bl$^WfBY_2?3d",hRH1n(mf#f\#EQ-]HVeCDl0Q j3g42PfC1qH/+-/;SlQP7oX\FOuUiLGDn`(m0s!pA`N%HgZpk,99$(^<K,\"I2$e. dZPN?VLLANX81?;66o.fKFX(;Lh-"nRaYk_/JiHB\6ZjdBm^c\B\mI+A/_j%V6UhM FQmX_42hQRNtANGdJ#?lP80uLbK1a#Zd$cXmfeU:2nMa"ODUJ!a(6BS_7A\Kmc>aP ^g)-3)f%N>D8UC^A<&rdO@Z_M*II,SGQ<s,*;f4-l@,ASqOdN>;s_Bg?CIWNDMNFS gndIR'9e,bn[RjK$rs]7:M,3]BrWDG;ECTp=<gpRg7@8jbo)^3%'-mW%k!&eR!5#s ?P;G`RS?/$\ch-&!Y*,O5<do>$j.p]&-sE6&:"Bj_$"caqYMp+hLNR./@'-JX`ZdA +_^-2D$<WZm&Fn=Q5D(5VCpHuk517;rrBH:l-%OkSW@2j-cCG8<^odLYY[WOWiD+# :D@pC$R<053Mf/FQ?cdb,?C:+NG?BH?#d1;12Y?e[I3KDL>pq@CO<ZjC1D%VE>uQf ;M^Qt7]6fm,?<6q3XT][k50jJcBc,<c[O[(m1Jbj2YXn%S%gUpa*s'>*JQY"]XG;R 9*js`](%F*+VD%b9s3U[QLZ;iJU^jKTCeger;d`7!,[)[l/A'ao9$V6_3C#UO(6a: @[user]s[/user](OA-\lI)XM-bI!UrOJqb#XT<.GOa[+)JTF]:\..SWJLU-;*%OPYq#HY(Z:3d.iK hO[EIDVD171/uRFEPXq:6&T45W^t:LU8"XZ,'nj?e-gRi^A2AXm/UTd9FV&rrr>ro X!$I6nCHs`l`p/"E)?m[QtS`r&Rr$8"`*B)3_3;rHQ>H(2]'67<SB.pBK&3rY-/dG PER(_,]/B@(5a"gP+Y/D$)so#/<7$B)&?:7`TDUNO*'-+\_<LB`P1hu&V;5G**!S# L,CBTS-^I@fFgch^8L;`9>>?6bKKgi")aT>]#+ZXQ?b*1)hXjc>BYbL@c8eZ(KgY[ Vc?G6cY7[=m_dm'I<Tp]':sEIG9,RY<nm>[/VNOr3X_M/Q9F(Vc^8n.i-E0fJid-( 5I$;Ci96+Z'-`-4Xo53k+8,Pp&,;2t>N@+lNt_KDa3m93'`34b'-URN))9Y"]UT), pXc?N<UXGa!o+Vb]G4F(/R7pJ%lFbqOYm9)9+jTKZ_GJ,,VZHj?7?8aS,g`F5=IEb M:>gpPH:UMH1iT.aOR[M1IT6I;4-?V:rJ<W\/IadLdJ?rf-9=5kLe\[4\]3.'P;+& Wd73imk%5\_&0De]?84-%So1sI>>G0EFeba_b09T>Zk@L,D(IrRPdVcEn+JdBmaV7 "2RbO:GPDE`ak+#@[user]pk[/user]#DeJ$Qh)NT($iSHZQ>+NWqb.U3-Yu]CLp9\qH<(R,pJdEZ^ niTf2_>aK9@>1G93b[=dqZjsD`%7hB0<WN'Hrjq"#I]<32>+`nrrD'Kb4b+^phF'Y 1G&SV,A.0L8oDB(?T0e.I#6#D]XRgrHcrD54/KC]\Lu@>Ejj@@[user]O^[/user]#$XMn9@6l<B7i Y2rl$p>*:fJF33ZGn$f"lq]e8<G)1PTD.6pl0M!ugJ8cri1l#HNAa8<`>GYAPPtZl 6,/W&F[kkP(a3EZ.\fmn8-3t]l^af-lfntshZ9e41t?N$`VJSPSf13nWMmb@X:Btf AsT#iddGJX0,g42Tnj\&1:XuJ.m]?=f!)j=P-U[TM[Q#1A9'4,-N='2Dsi+ZF*.'B f<<6E9nK*U/n1Ci-DHf`>)s*"&>=>WSseG7#k"C6[)j%L1C5]eT,T3T[VDh%Kt!t^ Wh-Yr88B+..V4cWR6QO/Lf't5S_-:8NWcs*W>_deTE*NmL>Fig!8\J-Zcj3Q.nQj\ X]>bfBq_,3jUt!Ed7G:8Gna1E!\ufBY]F/1[l9mRk3c=)p?.p3n%"3ijpd)oT6/f] (q/hPC>82.>13:^g@+C3D;0<BQ1]Pn%#rphW'(pXV5SBUL"m3AJZ@V!FPkpj<`<U. Uj`RorU8CbPA[\]&^=+/a31rtWj3NM\lsuHVO!oTrOb"0dlbb2OjkmS9X.P?D^MGM pmW%GD.B:*/Z#sXIl:3=$MUZ7,e_YW>oX3jM.0tm=C\m(KXe7j!XHJepV2&%l:^=[ p[<S*msb$"IeW;[leQpF^&-^#rrE)IhrEV-qqo*aYBBI:!;Gr2p[<S*msb$"Id>g: hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$" IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P* msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE ^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sp hnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$" IeW9Df=h(=^&-GHh&DU;G-T$83>i:Em6MYgq8#Ck>9N23\Ip.-7R`<U=goLbNS0kX NnR]Y*J@.\]&f6L2Nk@jn^3&hXdtEY&rffp-lorsQN=`2`!WWRN&4F^UlO;H^[p30 BammD?7C??>r:n4Yf=.'m8ggLo$G54@JbEiO(4*iCpmWP_e$KbCWY^<h65@HjKpXH :9:nn5)A$_Tsgho,V$EA:eObscRs)4e*_ECo5D2;\';/Jf$h'%EUDp<9d_StErtbK 51;Vmmouote_XNJ$lbN-,S8a!NAT!d/.s_6!'WdRrfC9MLs\K"1GslN%S<q0!#'MX fnufcO,rTh7`3.2/`/ik)G*enYH#LI;-2gnSBFn`H6m8H'P:NpG*,eL1baY`,=#`% 4f9@]ht4>LdAu5LF:Yo;7R\XA-DGW"g1DTE/N-1oR)Ip>WG*hYJcR$5fH25[/DH&j 3XLA5JldsUIKHP]/cNNnHNYf[K,[enoX,VgG0Nf]%$46uj5ML=1F#C@CcpLRUGB(Q K_m<F]Tkt9h"5kq=DK$=gjl>X$HUIT<4"4#N=A3Z"_t%bG\,7@5B4%b>9A#)m'ZTe gsmGnFMT%RTA^XhUR_g(W1]EXpfI?[=kFd+Vb;pr-9S-;m=/=ed[OsX\)!1>Pf\>* b\l_dJKlThBG\WhGcIlHAjmj#J4JHDgKo:JX_I2<cTER0DZ8Ku_n+JPY:<XjG?20# hUrjK[(<TWSYc/hXmIe>3ML&A-n](#6<m&gB^p@?>,8)VN8(:@[user]jA4`7[/user](6KNod/>R7 8Q59>qoOH4ea1Q2NQ_`5\6BtWZaD)i:JXhbNLW*G<77Q+.P#N0cV3C?2O00)*;^>_ e&LnW!03!:hu5M#'te`ZDYO$EhEWO2:r^$@[user]jAG3[/user]*Oe,.D=igI7AU3=cf-F''>Qdpj `R35bf@!RK;Fi+1Xf$oRRT92U"[m,W:-ZRiF`6t;jSK%*06;UVgU#gQ,h5tIQhCN0 ?Q3%l,W7kfqg*fU/bSYPBpRZl*lfpAIG8[gYAq1YP,-jVb)CSX/OtOkq7..`)K6s_ 0!_D0^2^OCmRlTtD6qTi]PZ%jEsuZ]CUh?`hfH-+8cJc)g`a5;;V?2P?BemIT4q\A `95BV""`*+ZnURGeL3Y"U5HN.WMQ!nj^a*6@K+$Ga4T-5_g1p6P`1!XNK#oJE"%of X4g_??VqVh[&Ok*Mub+@[user]EC[/user]>J1ke=kg$Bh<=#m>a6p.HZk3I@jJ.P-C"b*%\a;l:fV >TO.Z!O:S;SirW/AAA+ZGQ(A[r."(sHPH(^rrA=3H%+k*e*Wu]D$TDJ5[SZ!?!d%Y #,CU8m\Qj>'iO-Z4@iAo5WAq7N[LMjW6uPFH`tBX,k3MV_+J1!6_h"GYY?184>7Bl [>i#1La.sqIeqk<4Jqhp6R>-P)!WDI5g1"djF'1gHAhc7m_\u(_ljUN!4`^=n$t[C qTOH=<;uskYl!G&Y,mY`kiu0qJ7W;#Al_iLb.s*)";#Bop.+i,+iO*)*^5bGBK(?G 4Z&=Oae5c7Ul\j6Q2>-3DtR>iIQa7%\uL&p>+40E<Z5^D-)mi.c'C=t7Zp8NIgV'/ ZFSIEC5pEMEnfHJ(.p&[gl5Q4io3Y7<T\34o;.Eu2,(<u6#Ra(8o8cQ)Wa&AUY>O< k$q%kh<>@[user]fiKib[/user]?\;gj158,blVNmmh:-*Uf$+(aakMK^V4gdCHqtf>m]'G/QHQ@lX QY=%fY@M54MAXpt-&fB7Q<Rg\P3PP'juXkjO/e)3)5L/j#o\X/5(uNd";/HQ=H3os '<%X>4)\f];_Ok^`V-Bcl1S&5Lamu:H:8LlWqZ/Bi;Ep^UJh3l:FGuLao;?K3VI.# 2/Ts;oA,t%:DOaZ@ra<N9dh/7[h`#)=u`14j=Hp5NiK+ZSVFIH1q<8-)H:hj]<>o/ G:"+J?](bEZEFKj<0'NTB:`j!e::LU4A0`Pd6/`b+])]or15Uf!]Wu_];IHnW+iKH >[2Ph>^@[user]tI[/user]%VL)-KesA?g/H);'_+l(aJ()FiJ'd#&]lP*'f:1eoGHB'hS[ME[$ued N%e!I(-6WZ;)N(Y#5(!H!=WBsnh@cGDg_,FDf=dSr[ilEj;<f#C8g'RFo6P8$@[user]1Yi[/user] ioqYVEV/tEhnE<!m8htBq6Z(Y]o9F$18MVunY=DmEg/%>5N<,2'UBO0K5*`.UMb&E X*`]KqgA,?g7N?=PW?`ClujFbZ+8VUE8#6uD>'O'o#360FHSJ!h"Ma\SQ7h:1bh*E D/tsM_3\Qsp2/QTU;fN3W.M0TA#5$#/Fi!L7"R;.9.JUt@SgAr(e,Ca7V0a2S??c> Mqd!H,?DF*ROi&7X&DsKe'V%q$ku\kb0eMA;6!R2Gi4u6M.;iC$AKGi\N7ssor>.7 ]*aD\B(.Pp''LBS%K?FXWOMQ1r;0_dg?(*!^#c],RuqF%`[&aekpktm;9/'(8J.tQ J2H+#OP8^o!)`)C`:m<PbR_.cHE9b74>KEkV%QZtj98[)H<.&(_SDF\W_.B<3l#*3 h)(Af;o:1,O@r49,?)]XdChWY<-ZV?&M^X]D4mROVV6:g>rsR92YK'3OPCe$3O,pN O_Q8<2%nD9e3IT)-IMQ>/FZ>abcukh_K;/u9;rge-UUnb<,CiuC)Pm"M`"F/6<rD9 :JF>X/1LT!2UZm3P]?Q_E!`q=gSWN,c*JGZA")gFU:X'6M^uZ@UN]O)L0%7%"!PmP /"p]=Zt0`X$eu86p@!%^p:K-dZ^5R=)t%%BhY(8hjcuA[]sY58dDb0f#h2?2%E],< Rrj`s7hW52dG7;RK/C>Y*:_9L=6"F3B^4X))idn=L.Hn<Te\A)3$Y&6gRC-fa<`*3 aN0V97Z]=d1E*BW`5:_J[Bu4kO@?mTeXN4SVKW\ROP8@PNO,+M;,Gp+Y,SM@f0ueF 8ubt7;cQIeLgF`t2*Ynnd!`2M7e"#up<W8XQE8jV-oL".?%+8XAcOVc$uR]/8--4O O]5B(iJ9[sR0-SKW[m-pr!hB[!;-_brrB1.50&Y@(lMtm70K+IgcUofenPI;,Q21+ 5lUfblid+n,+O\HMk*F.Oc]SC9eoL<X(2*H'46bZqVQl(!+gZ#S$]s"ftdUfm])W. qn5KGo#UL6]Kc'ik+B`p!'Z;=\^:?VH/F#1'On[=/&iDI+7?UL&hg0'&-pRcgX%TN ;a!Q41<h>j,'h+8NV%r:>S$(G&,+l)#BA;?6.ape9i"\C"4t.KH`8O\Wkm(^ZLR]j PcCA>"oeQdb/<`X6iLstrq-j&!/U>\Hc,hFcDLUA`,2c/pRB/!;gTh(hOnf@OoPZj \CP*h"cnA'mJTeF<Oq87#LEuo9A(i`knWsc@Z0(oIPs+!qP-e3j8+`j0D+DenT/Ve /,T08=8keC(&L+/DEj[V3crF"/?&9*bV^m*jg,)n'&U=qU3->*#<uTZ(7?[fjYrL" =$Q(I:VQ+bV!pINAi/]Z0tB>Je6Muh!!E-!pD;\3^5rli!ri85Za]hZ*mS=C/2T2J ZrH@cSrTB\=:fln)L0g]P^gMH'S!@[user]][/user],Mrdf=_!Ik^53G4>DjLSTpFa.Ce#QBqZAQ^ bZp=mM.1^q-EL"eRb-`R<ksg;$o-M:,SA!65`pRA=B,FBZ%7F_JO4p<TE1(5+3DdL 4r6.J[;`4s38?A3-8L`$M,>9F"Z1>NnaUK0#a'V5LE=WJn*Ru3:PkCGBka2kY2kLj Ys7]lYHaGU*/d#ZSu+UEW\hs<+G6Cj_ks)ULJ&#9_;j3Yp<B&PiAU'af&lN[\EI&# 7+DhFZB:uS.H*P`e1_eDdKnoA!+lu_p)gJS;WQZng3[=MmUD0KeC2hDShrCa4_3[. 'D/f+RO\FKcQE6'<Bo^M[\9P?8Fg7p2_I9$G'6hi?8:VcVGJhk)TAUtRn]O";]uPf bRRkh5t_Vco[(QQ:C8Xl_$k)n;+@;&OiDrL'Fk2C!.RdRc,4APq0j7t^4L4BEP/\` Vhq<eCHGL96H2DDob5HG3k5p@UJ4"plQ3SmT)$:\*Qsp"jaG`ujR,\&^&!1a[G56F U>G^<IClnH*ocTHgh-N2[98l.[[Q"ug35QE9I"]b2l`coDOd<TC#4G?&XYVk?V_4/ L%mmZfE6W,^7`G_*S4@M<=V)>Q'(/+a_<1NRMaiOVHSQS;'2_%AK6c7jnl&9c9$7D 7ap+[B!s>$.=?__B[$*j'_CB8Bg]%i6X(QU;MIND.@=dkE#9%tXkPL`bLCCRX$oa@ a(*5gJgsl4JiMeLkZ*X&PuUdfJ1LrT"72`U/jj[?J%Kdi*P"tT7\$u^KedUXlD@eG 9]'nC3[A^H5epf$"t!K2.ZdUH5-Bj`YVsXe#rFD/a7P\#VH"W85]@[user]8[/user]/K56KqKKgY- Kr3R'lRZXmUWpt5+k4[T;mmtqOlH[EUoadc)mB\:%&$6I[>$lPrrA)jCk(0E5Pj%\ ZT[SN0-k?dYXN;f\6KUK4u&#uageA72\O@i$kBRL=/fXp$U=]@[user]fN[/user]::lhOiWIH+.SV p>Xhj[TK?][kHR\HZ\i3Ebpqf6>[JWB&'QuMCm@1X=`![Ki-Bs&j)G^bI4kqgn_lc HASS$WU&8u3@_#.ANhE61[A4gO?sXU!EF.WQ>;"MO(3rR;FaI0h-$[$:A>,C/>N(W =ZYi8_70_Ja"j\;VP%dG@R)L4ilZ-N9eK27Ve@?U0a8oe'.l,J/q/ag;?$V=>Oh'q p1ZbTJ#^9Qf;'MT4OX*WrR$gp^OB^-fnkJ!9g_3A]\-94a&t.F5dMAt\WjQaPu-`q 'Eb7-"B;bt;aN&F4>B,5j+sEuN\TbuE2j-C&*O#e9"U]7/I)0q9^5#K8pUo"3BZRo 9-#"brr@aQ,lE*-:DU2^ZXN%Ugm_4QP)\#S'Tl9p-pFT1kp';FObJ?lDSBf#*5a=& 0!#Ao2++F1GuB!/r[ekba!Qr&-D&rEJU1]f\8DB^pra-pV#J/IU*"csn=)o:qKLc9 QmBDN=cF_UYA)lQa9p\fmV!BfFP5@_"TJI[/58I3:fn]>Wr4K+J)m7ErP,9Ap)_Jn b&"E4mL!g?6Houn'hqCi8ICOn;c:K;67d[ag,)+4L&0F&@[user]I0ml-Bek1fp\K[[/user]?hjhL S:@[user]`F2RrZiJ[/user]$):jf<-(9Df%Z):400DMPR#j'c/Q9EUZIgPDVY6:qZ=eR$EBZQ?XYX Ul*C"p>:hJA$GUFNu:M('eu.[bV4V^bqj+#9+k!tDHia:[h!r^*f"]o(j62H=jSl/ baPmS>1&4CD'X^7;c8l<b]gM(P2[Fi[t3tLURiu_Q\m]2Jh*#k\W.PbR3I[LgV@Gi AQ_\\R0.\JU]ZWIMFEXFQ'Ht'#mT>FfTeZ#!0D%gp=1-59hr#d:uWTs2+6"N9L0q> EX&<<*04Nh^O%=+n,EA0]O1B-T`5#IMXP0j(rS,I#UP.$UgTgo#baOKiba0Uj1Su) h`=3p()n>7?i<iJWHeE;9T/j0\GTU%^LM.nW9+"R*!*@[user]W2[/user]#dPkA#0+DrdA85Z$IMK 0>+B<N)uH.H8*/(rGHEa0;li%#LK[/eB5pjWd`deOectl&2P8r.l>0TomnLh^U$H$ MRo[CH5\8Z\^`-,.Wlnll<%Lt_[nd1Kt4Z6b-\p\&,B[!hIM`J!6"aj5:V0F@TS'& <rW/G5/WE1g@^r=Bh_$V:G+tkXph-P)M/la.H@!++BBa@Om/lYnHV*Y:l7m&>*iNe g3\H\^t9"\=K\?nRSpL-VJL[/"Hkd2BMqlg6QBqn]WDV7Y0/ATb35Y#2L55m(^TYP e3``':H=BN.9B'Y&nIhPQDRRXGbNPh5V0j%&%Qs:-6Fq54K^=ZO\8d`g,LQSO7n<o 2JC1F_]`&Za<:*A0%IYSA[RN,GM:Ygg9*%RScU5-VM\@$P*jDQkq"8QL"+3D!3"': 5_Ii&CNg8$kI9V]DL)(r9D8O#g+>4Rh$nni2XC=UjNVbTa*eYs_?*RHeg,lh[ZPDY 8[OA%Fd\0$,^!76P*a>?<4]-Z/?T5@<%%Bl3=6ZmAlR8HQdQ0V\5Tj.cI;0j[OuHd 8b&1Yl5kPGUe=4>`3ijIWhQ$l+o_NhP'LW=n4s(IAt@U$6u=!mPUeOi5TjOA[*Zi4 "(EOA77?>/l6H8:Z*'G"E]@[user]0r_J[[/user]"=.reHRJJOk:NMOYje8b@TWYnte+'!QR*DM>4 f_Z"1*UC&tb/]X*,DDB:;q+a'\j/ipQ>.WqkPSKI,>^D8f#$8rWu5&-:Jln9NdPr+ 9g"XL'2k++/0jZ\'Se4[//]O-\q^E8#</PTm:qST7_]1%pjA>Q,t2'1%7JW@e@dt? .>DLc)IWuq(IGec66g>";Eu7.4n7[;Z/OL19[;-!8W9X*8b>GO:b*cXT`2::9c&uE [t6EP5,B(M?H%8t?>gc&Q^7XO6S5gZYe)'/'1fAONIc.Sa@`_+9hMRq7QDpZ5(30@ QG(N(^MU[7ZK7Y?qU8lbc*28%/]T[\4)K.^?eqR>0-.W;1"jR1`?*iFiCbc8U.^kQ PQmmd,9jcX1/kKaZAOHp>D'^(6=`=HZ_@KnqKl0'o6G)@[user]9eJVP[/user]#)4Ef#pHWRZBi$U Z<]Z'eS[_U%la3kbZ&^kl_(7;]Hceq_QZZr/*#qFUr??``u@(ge^.@?<?3npfLE!' C-`5APf5$`7k['6gOJ'SM:f+5TP-7\i+hL&?pA8(,.VCM6u.N@BW*(e;5bjr9pE_A R6Q/pmsas:lR7&]IJ_km;ado=qNkdn!,P4#O5IYJhnApE](]P*msb$"J,e!Tj57QI hnAojFn>V5p[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H ^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[ p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2 IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^# qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF ^&-^#qqo*ahnAojFmjeRmsb$"@:&Q\gQl"O`ZK&7*Q]USq=3^8QCaP:JKoN^-#Ed: Y"@[user]nO6so[/user]>O`;iD=Q&3oK@8l'sXKf<ndWM-c8?WG<NuW4'Wu,qd^q.J*A6_s+*@L@Y .L9s]G"_gCg9*?7/n*NqEGm#1[^s0+mHeDuCO;Ei#>8d7mI!m#:`QcG`>=RS;5/<j /$HY$iqCrE0L3Tdl`8g1."WD?cf\G>H[[r^m;r5.4fNE_ZS.#,'GHj(i.Ab*p;d.$ j4S87"j_!G4KM[kMn,i5YGm+\]>dcIeB?g*-:jeUH"uTu9QE]UMWjHGc`'u2/7WDV qhfVJ$o:hMiJM+K63uj!ntNmRFB3@E8#o%V*J1l,%)?-1p[;k+IFIr(e)&2^*#CCb Bq?bcFaY[#W!Oua9e(eS+F-e*7IA\MT5M(f:0Fp\YIAA4D1U[#D6N<7\0nX=h-=72 m;oa?g,7!<>DFKLNqF]e7qO-D(U<56O'V*(gPN*!h9?shjf5/C4P^EF<C?,Pl(/`* kGJ-dl4IHrC5J6Ir1Sg;LICY_3GcuN/*JIRldA1eF6+o%'Tmd7XY-OD]&(ZGL:Fe' [57N2n;mg;-SqFpb=Nimrg^G=dTKi"DIQs1A*\X1EdusEqq+-J1KBjU5'Lg@lttE[ 2#_eL.qH\!a,F`sWWB$$JtuF=,L_KX8t's;@[user]PT9i5rF`[/user].%t=5EDnJ^^M!eI"DBss- jbHgA6mJ!F%^/u;)7tF=Tu2p]*8erK>gp#blu?r"D"a?`V<6[GQn1/mpUdZD[X25: E4_&b_[/%gi(,&5<m$LQdndA8(C-GN/Fhc)q$`(ZKqJJS<d;93bnHL_'mt$)O:uM2 F3h56[8nMsAoNn-W$h*go`]pH!-g`s^W5"bfc,:Bp28ibbf-tFZbWUf216s1OO[3' !1#=Y63G6n*CMjYq4Wa%e#V0,_<'Q37eKYg1Dj2RTrH9`C76VUQRNV()<+2bW)oj+ .?6D],;bNT$u-IlH2$c>>Mf:%f3.Mm/YTaD=G=[(3$pLp@#g9m7`6&b0`ce]W<#>; 4fn@?05<'cg3-e=hfh5<H^X>0B\hV#V2d(ZieAeOf':u3g?RKs@?%(58FS`o`"Af+ .nD.+NkFabZ]n_(pCf8cM6!GNa5s958iY(-2Q]K3='\,jfHs->Bu;?"SsgsG,A03X XjOQBkU3C4HtH.h:=V*D;Iugr-!JqOl6rs\L+ckuO?!`jpAI2<J#-H7#*G4M$iZqp -,8:RJ&o=-jnFLF2]n)(:hCg"M'r8bfeUbDp@c[ApKm%$@[user]qoM6[/user]%F^WAU(&>EjQEsH VKJoZ744)U'\85"&k.#+Kqf='*.g&>,IY)T2%kO'ZKngHE<./DBl!6=ZB-Z<U+q_0 L#b/Q_bEn%&(,a/1LC%Hb'n2fq@pEp2G5"Q?r]j,eXkWB&S"cjob!B4#LF@\pgKYJ TMV;@[user]YO[/user]:k)b+"[Io>lCEo2dF041+V7n)2i8)ogL@geE!4FL)FNqB9P\^b/q$G+;mO ;%CSV,jd(ZC\="igc5/tgU87oCaMIdB[C:"a6%+aL-mr%_^)>pRA_#`T3>2_;"HMZ O,g5Rj]Jd*)GTh5.nlFbB'otHD.T01/1sPPU8e.m1=&Q@?6^t^=dkp1,AqVC"n%tV hO4:i,14fhblfM6(-*4\/bh7(!-n?e>[mTRI:DH[4F'PS5V*"0`.,3S+4KcH)dIj_ ltBmiEmbu![>Uie@A&nHc/o(haTZMKYo5)L?l>_cBPJR>eP:#kn;=a"?9\lf#!3Vm %1O%5l&)&9d\Hb>0dODp\b/NFXRaNp]T13-1]@[user]4[/user]'HM;HGm1ohb4%guh]J_\%ec^"A A9.&-:H97JcLOP%`@[user]Dc2-[/user]>m&Kb70&K[p,?6hI5PngN`+p*bjKFRSDMuhDR!P<m,8s D.U*AEQUt;m9<SmV3d'6`6lnSo%_>CDtMUkKZW["-JJ6;,"JN4AWJKC)!&a2mM4qc LCS'.8ra/gJAORGhd*-I97VY)m.tt3\4SI&putjHaN"3NUi'@=j_M609$JoiFi`pi =0STBFuJO=`;]fKYF3bol`Aj)r<9m.#qTu4P('3rT4$Pkj0s.'gIF!+EUR6]hlEo^ R:Bo5]X!t<"E-u^`DJHI`=5L>$?F(\Uc*k!]ubo8+bh79hU(+=Wpg"WS7/4lK3/,_ gWo7`,dE9,%.s'q>tEHTY@?D(HW6K:Ze8MahX-G1/Vog&\;'!Y>FcGOo=@[user]Qo[/user]!3I6! i^h%(&C<,<-&W#rGlrK'k'gb$N`YDG_e#1'+)[Qkg%QM^DVqlgF1,qo]1ou`KtB7t HY#!9=i.M1ga$*\46BTN!^`sAeCj\gV&`n"U])F!TrhM;VS$H`;oX3%'?Lp4*364k ,DigmFp^OA#OU]2aAq<XZ>HeUE"t/:cTtonX3d#[V8Y;^MBbt/WCf_.6Zci^FHB*. +-WeFcF#K-4;+X'A0`,o!3SJ@oUWn3WR4U9a.+OXGo<*&DsDb%4,Udrp0B?GHNUa_ H[>ip,V>8*mPmDM=_Zl\AJ!;<#'hJQaVq]D4H2@$L/t.)V.UQef&!(RfP3Mq3&fU? ,ANN;)6.>3N0Dc85QJnWN(o))1slp:*,)&?hn?@[user]A][/user]!]MY<Yk0pA[fQ-:+`2S,Vn.1 KJs\[aMk!?+OHKD7)GV=-@[user]EAF[/user]:i.0=pG["0XlhM3Ic4]NdehSm(7(*Mq`HYl_JL5E h.7RLqek9B/8f>+H^hXJT@LKaP_E+k[Q;HPDG%9f*.:R3L-hW8/XM&])H\H]%<=rY Tk:<?"/R+LW;7cQOdX^2m7kd5G/h_CFdCR>b=.:[)QKX%>&*?fLM:NSC)I5>2+5[, ..kIqM?rjn&h"!*IBU5&0f2A!TgfeY)1f'+re,V.C+<krOeo"=V3-b\0dMp3fCfFC :<:QF8j%Q4%0Vr]R$=P(VM64"U8!f\*/c*oA(<-[nfqHD]TXVU[&ieNF?\":?298r dI"cVCGSG:"XP*+>`C=7E2.-))NlQ3Lnug(Td(fa3)Kg\k\"C*n(u:UH')$?MeKlZ mC,0(Bc9WFQ<@[user]U[/user]?9:')q6Uu)68#DW3krMqN$U??Cm%!fVi*Q;=arL/iE]3O&=khVN "C$;/gU^SVOkWBE$9H#6/=-##Zo46/ba/!:-AYG97jO99>k.ThXMbPX4u6&A"$DK4 SBk+QL"%R#lR^+XlO$riJRKC0!lj5*<5".#n<bf.=gE,%8T6NV@e#_*pmeEc8O3^i l"R2@;Tf<*M(MLCkO"E^B]<1:0g)TNdT0=DcBT*l1fD=\.k._+)idFnHAB1XeI;eX O!crE:a4as2?3dRp6'gc@i'm?e`M&RI=>4s;]SUtCIFR&6sRn\?<=2-V,3:B,DMq( Q/XY^RNpd&.TpuPg"tJmF6#-AgHRDc9i*9JVhT;Dc6B-^L7C*W3SlJ9N>kHc)3kr& 4\ett`uj3P[BoH2fkr+J[G1(Cbf_PRme8m``@[user]S[/user]&CLE&Wd.]Q>\8M&RrR^-[<mROUG H_%Lqo(N%-*5N]>\'JK.'Ge.S.(d"(Z*Bn=?JaS][lh"?3aGub.R]Trk%RHo5Y/a= pFfib2Sl5eYCO&RHO4BLh.mH][j!bQ+W6MI?')F*9B]t\2nnK:]<JVf>8O[;[7IQs Ws"/-J3QmDc@_=%_*?E7m?]!/Z^Eq2nJ]!<-)f@m(1KNf\GlONpRc?MG%U*<!GV*[ _Opp?G99WRR")R<*8l$i@T/6*j`WQEa%\$^;bL5S;cMdbO=YB6e'9EfOr@nKDTlU9 &H_eKP@5Ef^&-J?h!j)ji^7K%TJ\;@[user]E_R_n[/user]/58Wnm`Rk09giI(8NabqmX%Bj[+r3D n!I5dCB`8UQJ5tj*&5C:pi6hHg="hi/>^RF"DY>(%Y\6EVql^?-]b=Lm%!e+X]e>! CD'aCX.W&DJiKWLX+F5ISB.j3b^n>.3e94RbH5%qZkX#Q_U:p)@;j;[IB=j_^"6'u B<RIp_T,Tc4T>D<,bOlSZqXh*[?EH=*E"mDO!aTcj6W:SSVOe"Y3Dq@(`GHhM?h5: ?QWX7L$E"e/'_l=4]F-]Nsa@Y`\_t'WN%'h%$'I`OaX_5YAN^P)#>d12\fm1<Ocga [Eq99^SK*g<E0K(2.+^fGi5N$H]njlP0oYhIeG([Rgn2E]JnS7hg9Q_&;gk]JF#UQ !,3SNAS_Q^BCK($N)V)s+1;((PF":rGhi*rgeMkNNa1]SpY9tA<SCumL,ik.hFEIP F>]Z,&7fILRL=&j;-MBbpAi;TaKNSB[nRl[(?jIOq$NO'C*L_b<Jc:m.WO!8Y`Oa2 GZ%*G'n-Nb'2hU6pnVOS/4",IYko6CZI<>qg5h"bo9h/cI2.2Y&Ka3G:VA.%;LZAp 8*4Y_XMk;`\ALE5l-/P+KrN&Ab>.=goK+_Tn\H9b*1qKEXJH`d:R%e4Q-t/)\J?FU J+qjh*m26/FgbC1$t6+*qj/fma].HpZKda%b(oisVF_K2JrU*P3Q3!iDl"Y$5[BVd $@[user]QoVbgBm[/user]=]43S'1RQjol"5SCS<6aa0Sg.C`atEM4O?3qPsnUZL7IL/e*7"<^O&Or ba0.C>WZNaZnmVaP$"k[b`aT\B%"Lmee&lp2Mg<(LlsS_79*.aO-fg/g%eR=[n_>4 Xm^>bB&5-+XDdf#\(beD\a1nHD-<TYDQRO+RdU#X\6WEYD0g-g0.q-[B:<P2Oe7s( lZ5j#L>2St)ND_'#/.=M0GGR2=A]E=Q8WlC#ijB3@S\.V,U&Sul79"$6b;SA-ICK" SXl:e<pdOmd7[\);U:<$NgaZnL..OLVj82HJYNYoYluq!=P].\fE"FOZP4.VOJf.E C7+;WCMd-"pV$%_o!>V\<HN'm<^KrOKnsqrin!shIicMQ`7QoYk8>7T.T,<k9>3Ht e?j_8#F:OO-n]4H.Z@X88P^feZ)b'o)2jM%%aF;*N9sDqY*,5OU956-RjEil<&[B2 oOX17K&=Tmb7.&g1.[jVa6`$epUfftd<2qO^=dLCDn0_g?h$d^Bca/&_C5X\WIFds XenkgoJ'fRF8l6F)](L*/Z1_tgZJ+Kr:+AD;9V*(7pE54?V_QSZ]dYaPqBbiHs#R@ 1YR>9h@#\d,`TDR8P*3k#EbrW.Fpi829r%nL1^(b<<7!WQ>7n2O;T6R8Prhf_^^tE D>#%*JuT*bp-UKcY6rf%@[user]nBOc_c2[/user]?"MPVeB_H!D3$%EmUe(#o\PJU9UI`"`(P$(t# ,Wcs.$,-;>[eF;"XgOs7E`E\qr=DTZEW-c`pj^#eZMsnpgRH5/MbcXi\I%R4#%9B7 UfRKq<?a=N0bOpgF"M-W8@sjHHPSN'DRjc8<:9CPVo[B;]WgG['ms-[9aHm1aYM1= -^;3a.kmDgTu)'ng/1`9hU#VI2HLJ-Cpn+R\R!+cM_330_:+L&/]<Sl6?9q&e=$Qk VQ*(tWQC[XZeia4F%<cG`QhCd_'Qe&S@`sbbPO=,6E.K*Yh<ieQZ0Q*"_!_jp1WL; nd#Z`.:_=4Z8Z)rUII%LmWN2PE1$LqJhfmZ8Yi&?-kL,i>%pu+V7R1(g\uQ$14*(. Q+MaLW:EkC&WVaC.Z#V7"4FMK%$JKV'6YQK*>M2+AZcd5UVF;"6ma;&bKAR?]:Yq' J$8aqYerE2F'F5`-;LjLaX#Q1L_p'k>l-*Yf<Fia*/#9+%7r`Q1Ii0$7[B?!SuNR( Bae!=_&-l4J`;b]09',-0mR#Kh3pNSA$^LlWZ!udm&>$5W>mai+X1"7`,r/9W5q)_ 4Zm8*)JP0&n[%L1Wa$r-?N'603L(\%[bH!8Wmbr'+dU8rV4K#f8,t/r8i2D*<?Yn3 3[+e4QWHGQY@HuPH1QCGN_]<NR!C.VVFY=]IBROng:%nX)5CZh9lBj(2_`q.,<XDU P1a0T]uA7>gU(ro?lUULQ2-;:QPE4HI763lkG"eBR]f2h.m,ZYL6cs#[*#X(4?tHO 9R>DI5;<sap5N*1CUR8YY:g:uoQ+TlK-<ZX3/0.+f&YtnV_jXd4D5e5U$?$:jjrZ9 HIab^@[user]ktI[/user]%MNk08RGaJM19rW5EW.38Zod;sI?:0`3QtoR!b>g*[B9-$T#+7L`,<6= d_nM1UlM3-8X.8+X4&.ICE.@[user]m[/user];H7u`MsjguA4<V`-\XiD)AE7U24o+JrMN^g9,(U: B(!<L8J,!;..HfWA*P$A)/7r!+cuo(?,Td3,7;LAALhdUHhXm%DRS]M.iZa=$^dTY H/Y&<VR<pmg_DRkZ/WdNSHo;(7"C1_>*:GNpAY,;:1q<'^09]jf4D\P2U/F@h!?]f h7%jdY2e3`A?rfC8J]26$e>*CL6?4o'b[nEC6(Y[<8L\ck4!XEEHId%S@F`R:DG_V H=hu>I`kJr&#NaGDe<i2dV_Ra:%=:hjQ3;@[user]b3^4eJ[/user]B@SK.Y5Lf^+u]]+5`cjd\Oo< =-6qnAWG&fVIG8XTPF3B>-bp<PgrYh<kVs:7c</$+3-RrF?R+FW8h!>FH]1E"V0m8 #P\sN@%M:[DLL\6;1dK5>;\hj:)PKqo@nkdpf/Ut,jV1G96ZWCnjMiY6tWBS=L9p2 +\<8gZ*nKbahfA[Sc7WGBD\3YBjE'cXcZGE?;,J2.Z!?K\^J'[M3^^NQ<sOW]:IHn BD]9cg,g5e.%XP(8LBngAJ@YFSjQW`A,A6J,)K*=K)OLWf_GP!q2Fp31%.&+e]gtD 51R.">hW@ugO@2P9)^-][`Po0WCp=+I,<`9>i0E4TNcDXQIU\X0KjotF4F.(N5O8A aE3mIqK[)1&>K4D=/_ZZTShH\_BbWAOZBZ>@[user]J[/user];BIDfo\rIrI*,8RIe+:3%;/,.7]] ^#DS?TGK?1d`.1S/0pc:Y#i9bbj5[<G4+XsLr:bO+b9ck&bZ/(=H?muD1,_WAtH/L RRSQgFtNCe!+4Wsqqo*afgep^;-f*l1&A3lrr?qTmuP51pV2(L^O,^iFmcs3hYlp" rrE)KhrEV-qqo*aYBBI:!;Gr2p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S* msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAoj FmjeRmsb$"IeW;[p[5`H^&-^#qqo*ahnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*a hnApE^&,!Umsb$"IeW;[p[<S*m_.5cqqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTY Hf)O6hnApE^&-^#qlb/2IeW;[p[<S*msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S* msb$"Id>g:hnApE^&-^#qqo*aYBB;_p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pg p[<S*msb$"IeW;[leQpF^&-^#qqo*ahnAojFmjeRmsb$"IeW;[p[5`H^&-^#qqo*a hnApE](]P*msb$"IeW;[p[<Rsh0\%mqqo*ahnApE^&,!Umsb$"IeW;[p[<S*m_.5c qqo*ahnApE^&-]upKmU_IeW;[p[<S*msaTYHf)O6hnApE^&-^#qlb/2IeW;[p[<S* msb$!^"9sphnApE^&-^#qqo!Z?MEo;p[<S*msb$"Id>g:hnApE^&-^#qqo*aYBB;_ p[<S*msb$"IeW9Df=h(=^&-^#qqo*ahn&Pgp[<S*msb$"IeW;[leQpF^&-^#qqo*a hnAojFmjeRmsb$2e_fEE^&.p0qqo!Z?U+PjIeW;[p\4IWmsb=eIeW9Df=h(=^&-^E j57QJ!WDoQ](]P*msb$"It*N.p[AF^msaTYHf)O6hnB!f4o=-P+5ad/YBB;_p[<S* p\=LOIfOtIp[5`H^&-^#qqp;khnApgrVPK`pKmU_IeW;\Iuf'Qn-A^VId>g:hnApE ^&@[user]pnqqo12hnAojFmje[/user]Rmsb$*q"O6,!.TIlm_.5cqqo*ahr!JO^&.p0qqo!Z?MEo; p[<T]O+-im#P[\9leQpF^&-^#rVetWhnU>k^&,!Umsb$"IeWU3p[<S3It%.[^"9sp hnApEhrEV-quQcnhn&Pgp[<S*msfhJIeW=:p[<Rsh0\%mqqo*cr]U/9^`VIIqlb/2 IeW;[p\4IWmsb=eIeW9Df=h(=^&-^Ej57QJ!WDoQ](]P*msb$"It*N.p[AF^msaTY Hf)O6hnB!f4o=-P+5ad/YBB;_p[<S*p\=LOIfOtIp[5`H^&-^#qqp;khnApgrVPK` pKmU_IeW;\Iuf'Qn-A^VId>g:hnApE^&@[user]pnqqo12hnAojFmje[/user]Rmsb$*q"O6,!.TIl m_.5cqqo*ahr!JO^&.p0qqo!Z?MEo;p[<T]O+-im#P[\9leQpF^&-^#rVetWhnU>k ^&,!Umsb$"IeWU3p[<S3It%.[^"9sphnApEhrEV-quQcnhn&Pgp[<S*msfhJIeW=: p[<Rsh0\%mqqo*cr]U/9^`VIIqlb/2IeW;[p\4IWmsb=eIeW9Df=h(=^&-^Ej57QJ !WDoQ](]P*msb$"It*N.p[AF^msaTYHf)O6hnB!f4o=-P+5ad/YBB;_p[<S*p\=LO IfOtIp[5`H^&-^#qqp;khnApgrVPK`pKmU_IeW;\s4I~> endstream endobj 58 0 obj 0000000000 65535 f 0000273492 00000 n 0000273556 00000 n trailer << /Size 3 /ID[<a0013c26fe024fc2458bd465de94377a><a0013c26fe024fc2458bd465de94377a>] >> startxref 173 %%EOF

[Ei aihetta]Tiistai 04.04.2006 08:04

ERROR: 错误参数reid 快速返回 IE5IF4HG5JI5KJ8MI9JH9HF9FD7GF9GE8FE:FD9FE7FE8FE8GF6DE5AB2AB2??0??3<<099-67,67+69-68,69-58,68,69-69-69-68,57-57-46,68.79-79-89.89.79-78-89.89.89.890890892781781881781781781781781792:;29:/89.89.79-68-89.89.89089088189278179/89088178178189068-68,57,78.78/78/67055.44-34-56/992::3::38929:37817819:3:<2>>7=>7<=6:<29:18:.9:/8:/9:/::1;91;9188078/79-79-8909:08908818817818909;1<>2>?4<=2<>19:.:;/9;/9;/;<1=>3>>5==5><4=;4><4<<3==4<<4==4==4==4<<3>>5>>5>>6>>4?@[user]4[/user]??4>?3>?3==3>>3==3>?3>>2>>2=>2>?3>?2>>2>?3?>2@=2?>2>=2>=2?>2?=2>=2?=2?=2>=1>=2>=2=<2<:0::/::/88.9:/9:/8:.78-46+56+45)22'11'22(11(//(..)./(44)56*66*57,66+45)12&0.#,+ )*'(&''('(()()((** **&&$%$$$%"#"#!"!!##$$"#""%%''((((((''))((((**"((&' $$"#% #$ $%"''#&&"%&"&&"&&"&&"%&!%&"&&"$%!%&!&&"%&!&'#&&"&&"%%!&'((''%%%%$$##$$####$$%%%%$$$$$$$$$$$$$$$$ &+0$')!$(!$)"$)#%)#%*#%)#&)#%("%)#%*"%)#&*$&*$&+$&*$',#'+%'*&')%'*9>EW_j48< "*,1...$$$ZYYЖЖЖГВВЎБЕЌБЖБЕБЖЌБЖЋБЖБЗБЗБЗЌБЖЌБЖБЗЎВЗЎВЗБЖЋЏЕЋАЖЊЏЕЈЌВЊЏДЋЏДЉВЇЋАЅЊАЅЉЎŸЃЇ“–™˜žЂ”šЁ‘—�‡Œ“†‰Ž�Ž‘‘‘”“”–™›�˜™›”–™š››˜˜˜‘‘‘понџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщэьсцчяѓѕѕїљ№ђіфчьнтшкпциофинфзнфинфинфиофинфзмуинфйохинфинфзмфзмфзмуинфинфинфйохзнужлтзмузмузнфзмужмтзнфинхйпциохжмужмужмуелтектимцVZg!%77;J56= $"&)),1)-2*-3*-4)-3*.3*-3)-2+/5*.3',2).4+/6*/5(,3)-3*.4),2(,2(+1)+/!jrcho`gmcekgelgcji]eeT\\ITSBLL9CE/:A*4;)2?)1B*2C.4H29L8SM=XRB\VEa[KfaPieTgeTgdRhdSheTniZkfWhcTfaRgbSa[MZTFXQDVPAWQAYTCUT>PP8MM7IG2BB,=;,;8/:8-:8-98.:9,<:-><-=9-:8,63)2.$3.&1/%2/(3/(84+;8-=8/;6-85,85-75/64,63+53-42,64.75/971:82<:275/64.64.64.64.65/75/64.64,64-73.74152/52-53+42*54)21&20&1/%1.%10&20)1/(1/)/-'.-'/+&.*%,*",*"-+#-+#+*",*",*"+)"(((()*)+ +,!,-!.."12&76);:-?=.A?2CA3FB4IE5IE5NI9PK;MI8LF6NH8PL;PM;OK:OK:OJ9OL:NH8KE6JE4IC3JD5MG7NH8NJ9OH9PI:QK;SM=SM=QK;PJ:QK;XQB[TE]WH`ZKb[L_YI_YJa[K_YHZUBWQ?WO=UM;RJ9RJ9SL:UM=TLRLYR(@=&><#A>%D@,EA,FC0HD3GC0FD2CC/ED1IE7IE9FC9FD9HF9HF9GF:FE9ED6DC6DC6BC5CC5AB4??/@?/?=0<=/::-9:.89-78-69,79,58,58,68,47+36*25)35+24+24+36*45*67,79-89.68-79-89.89.89.89079/7819928929929929929928818929:19:/89-79-89-79-78-79-89.79/89299289299278178189278178188168,68,67,57-89067.56/56/45.45.56/8928828928819:3882881:;2:;2<=6<=6::4:;19:09:/89.89.8:/::1;91;9188089089089078/9:19:18929:38929:09:1=>5=>3<>2<>2:<0;=1;<0;<0:<0<=2==3==3><2>=3=;3==4<<4<<4<<4<<3==4<<4==5??6??6??5?@[user]4[/user]?@[user]4[/user]?@[user]4[/user]?@[user]4[/user]=>2>>3==3>>2>?3=>2=>2>>2>>2=>2>?1>=0?=0?=0?>1>=0@?2@>1?>1@?2?=2=<1=<2<;1=<2::/::19909:/8:.8:/89.78-56+56+44(23'11&11'00'//(/-)--&0.$.-"--#..#21&31&10%//$,-!()%'&'$'%&%&%&&&&&%&%&'''(%&%&$$$#""!!####&&'())*++, -."-."./#--"** (( ''''!('$))$()$*+&**&))%&&%''%''&''#&'#(($'($'($)*&))'&'#$%!""$$ $#$$##&&))(( &&$$######%%(())))(()) ))!))!(( )) ))  &,1#&* %)"&+"%*"%)"%)#&*$'+#%)#&*"%)#%*#%*$'+#%*#&*#'+$'+$'*%&(%&);>EY`j58=!$,-2.-.$$$YXXЖЖЗВВВАГЌБЕАЕВЖЌБЖЌБЖЌБИЌБЖЌБЗВЗЌБЗЊАЖБЗЌАЖЋАЖЌАЖЋАЖЊАЕЌБИЊАЖЋБЖЋАЖЋАЗЌБИБИЋБЖЋАЕЊАЕЋБЖЌВЖБЕАДЎБЕЎБЕЉ­БЈЌБЃЇЋžЁІžž ™™™���ппоџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщььрххяђѕѕїњюёѕуцьотшлрчйпхиофзмузнфиохиофинфинфжмуйохинхинфжлужлуинфйохзнфзмуинфзнфзмфжлуемтзофзнфинфиофзнфйпчиоцзнфжмужмудктектелфTZf!%97;J67> #"&*),1*.3*/3+/4,06*.3)-2+.4*.4(,2(-3)-4(,2).4*.4)-2*-3),3)-4'*0)+/ inbiocinffljgmjdik\ceSZ\IPVAHM6>D.6@(08&/:'/=*1@.5F18L6=P>EXHOcRYs\d€gn‡mv†w€�†—€ˆ–~†•|‚‘{��x‰sy{outcji[c_[c_Z`Y\`Y_dZeg]fh`klYooUnnUnmRolRnnRooQooQonLpoLqnLtqOvsPvrPwqPwqPwqQwrQwqQwoRxpSxqSvsTvrSurSurSusSwqSwpTwoTylVynWynWyoWxnWvmVvmXvmXvmYvmWvmYvnZwpYyrYyrXxqYyrZyrZurWsrWvsYwtZxuZwsYupYupYupYuq[up[vqYvoWvoXwpWvmVuqRuqOvqOvpPuqPwrTxsXwrXxsVwsVwsVwrXxsXwrXwtVxtWxsVwrXwtXwtWxtVzvX{tX{uX{tXztXztXztX{uWztVysRysSysRytSysRysSytSysSytSysS{uUzuT|vV|wV{wVzvV{vVzvUzvUzvUzvUzvU{wV{vV|vX}wY}wZ|vZ}vX}vX|vX|vZ}wZ|vXyuTyvTxtSxuT{xV€{Z�y^‚z_‚{]‚|[�{Z~xW~wY}wY}uX{tVzvU|vU|vVzvU|vV~yX~vY~vY~wZ~wY~vY~wZ~vY~xW~xW~xX~yX~xW~xW}xW}wV~xW|xWzvU{wVzuT|tU~sU~tV}tU~tV~tV}tU}tU}tU}tU}tU~uV}tU~tV~tU~uV}tU}tU~uV}tU}tU�xYƒz[„{\ƒz[„{\„z[„z[ƒz[ƒ{[„}]…~^„}]„}]„}]‚{[€x[}wY|vX}vX}wY}wY~vY€wZ€wZ‚y[‚y\�x[‚y[ƒz]ƒz]ƒz]„z]„|^„~_„~_‚|]€z\ƒ|^…a…a„}_‚|^�{\yuWtpStpStpStqTuqTwsVyvY|y\{x[|y[{x[~z]}yZ{wXzwV{xV}xX|xW}xWƒ}\‚{]‚{]�{^‚{_�z\€z\‚|]‚{]‚{]‚{]�{]€y[€y[y[€{Zy[~xZ}vXysUxqTwpRskRkbRpdWtk\~ufŒ‚v™�†Ѓ™‘АЇžОЙБЫЦМбЯУггЪбвЧЦЫПКПГЉІœЁš˜œ–Š’Žˆ†„‹†˜œ“ Є˜ЋЏІЗКДОСЛЦЩТЬаЩЮвЫажЫЮдЩбиЭдлагкЯембЯзЬЫвШЬбЩОУЛДКАБЖЌЎГЉЉЌЃЁЄ�›�—™œ•˜š”›�–œ š›Ÿ› Є ЃІЃІЋЇЌАЌЊЉЉЇІЇЂ Ђ�™›˜•—”’“‘�‘Ž�‘�‹Ž‰‰Œ†�’‰™œ•ŸŸšЅЅ�ЊЊЁГГЌЛЛДУУКЦЦМХУКЧХМТРЗМКБИЗЋБЏ Є ‘˜”‚��{‹‡u‚}l{tc}sb{sbwo_vn^um]um]vo^vn^wo_yrayqayqayrayrazrayqayrayqayqazsb{sc{sc|td|td|tdzratl\ngVleTkcSg_ObZJ`XH]UE[TD[SAZSAZR@XP>TL:QJ8OF6JA0G>.F=-H?0I@1I@1JA2LC4OG8XO@`WH_VG_VG`WH_VGaXIbYI`WH`WH`WH^UD\SB\T@]TC\SB[RA[RA[RA\S@ZR>\TAbYHbYHbYHg^Mi`NmcRpgUriWukZulZvnZwo[wnZwnZvnZwo[wo[wnZwnZwnZwo[xp\wo[xp\xp\xp[xp\xp\wpYxoZyn[xp\so[qjZleUhbQg`Pe_OgaQkeToiYtn]tm]piYgaP`ZJXQATM>SM=XRB^XHd]MhdSnjYljXheTebQgbQfaRgbTfaRc^Pc]Ob[N\VF\SE]UG`XHa[I][EVV>SR;3=;1;9/;:/=:0?<2>:.97,53(/+!0+#/,%1.'1.)50(;7,;7.;7086,96/97176/64,64.75/75/860:82=94=:375/75/64.64.75/64.64.64.64.75/740:7485385163.74/21&10%1/%20&1.%1.%32(42(1/(0.&/,$/,%.+&-*%,*$,*$.*%-*%-)$-*%-*%*("(& (&)*#)*#*,$+-#.0&33)77,;:/?<2CA4GE8HD8HD6MI:OJ:LF7MG8OI:RM=RO>PM;PK;NK:NK9NH8KE6ID4IC3KE5OI9OI9OK:PJ:PJ:PJ:RKXR>XS>XR>XS;TO7PL5LG3HD-FB,EA*B@(>>$?=&A=*C?*D@-C@.A>+@?+??'A@*FC0HD3HE4HF5HF5JG5IF4HE2GD1DC/DC/BA-BA-A?,@>,?>,>>-==+=>,;<,;;,8:,78,68,68-67,68,67+57+34)35)25)34)46+46*56+78/8:089/89089089/79/89/7818827717817817818817818818817819:09:178/79/78168.89/9:/89/78178188189299288188278188188178-68,67,67.67-57-45.44-56/55.66/992881892::3:;48927819;1;<2<=6;<58929:179/79/89/8:09:/::/;91;929:08:09:09:1:;4::3;<3;<5<<5;<5;<5<=4=?5>?5=>3=>3=>3=>3=?3=>3<=2=?3>>2=>1=<0=;1=;3==6==6==6==6==5==5==5==5>>5==5>>4??3??3?@[user]3[/user]>?1>?3>>3==3>?3>?3>?2>>2=>2=>2>?2=>0?>1@>1?>1@>1@?2?>1?=0>=0@?2?=0=<1<:/<;1<:0::0:;/:;/9:.9:.:;/:;/78,57+67+44'32%21&01%//%//'/-'--'..'--'..'//(11)11)00)--&-+%)' (&'' '' &&''''!''(( (( ''((*+ *+'*'(%&$&$%&''()*)*)* )* +,!-.#-.#,."+,!)* (*!'(%%%$"&%"'�'�'�''#('$(($)(%''#)(%*)&+*&((#)(%)(%))%('$%$ %%!&%"&&%%((!,,#++$(((&$$$$$$&&((!**#))#))"))#))#))"))#**#**# (-3#&) $(!%*"%+"$*#%,#&*"%*"$)#&+"%*#&+#%*$'+#&*#&*#'*$'*$'*%')$&):>D[bl58< !$-.4/..#""ZYYЗЗЗВББЌЏГЌАЖЋЏДБЖЋЏДЋЏЕЋАЖЉЎЕЉЎДЉЏДЈЎГЇЌВЉЎДЈВЇЌАЇЌБІЋАЄЉЏІЌБЄЊБЄЋВЇДІЕЇЖЈЏЗЉЏЗЉБИЇЏЗЈЎЗЇЎЖЊАЖЋАЕЎВЖЎГЗ­БЖЌАЕЌАЕІЉЎ ЁЄ˜˜˜‘‘�сспџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщььрххяѓѕіјњю№єуцьнсшкрцкпцйохжмуиофйпхзнфжмуинхзнхзмфжлфинфзнузмузмуиохзмузнфзмузмфзмфжлфжлуиохзнфзнузнфзнхйпцйпцзофжмужмужлудкудлфTZf %78=L79A!$#'*(-1).3*.3+/4+/4+.3+.3*.3*.4)-3)-4)-4)-2*.3+06*.4),2)-3*-4(+1)+0 jnainaioefjhdjfagf[`bSZ\GPS@IL6?D.6>&07&/;&0>(2@,2D18J5 CXCJ^OVo]c~hoˆmv…s|‹}…”‚‹–€‰–�ˆ”�ˆ“~„Žx}ourbih[ca\c`Z`X[`Y_d\eg]giakmZnnUnnUnnRpmSnnRppQppQonLpnKqnLtqOvsQvsPwrPwqPwqQwrQwrQwoRyqTxqTvsSuqRurSvsTurRwqSwoTwpTxmVymVwlUwmVwnVvmUvnXvmWvnZvnXumYvmYwpYzsZztYyrZyrZyrYvsXssWvsXxuZyv[vqXvqYtoWtoXsoYupXupVunUvnXvoXumWvoSvqOvoOvoOuqQzvWzv[zvY{wZzvY{wYzvYzvY{wZzwYyuXxtWwsXwtXwsVwsVzvY{tX{tXztV{tX{uX{tX{uWztVytSysSysRysRysRysSysSxsRytSysSztT{uT}wV}xWzvUzvU{wVzvUzvU{wV{vVzvU{wVzvUztV|uW}vZ{uY|uW|vX{uW{uY}vZ~wY|xW|yW{wVyvU{wV€yY�y^‚z^‚z]‚{[�zZ~vY~vY~vY}uXztV{vU|vV|vVzvUzvU~xX~vY~wYwZ~vY~vY~vY}wY}xW|wV|wV}wV}wW}xW}wW}wW~xW{wV{wV{wVzuT{tT~sU~sU}tT~uV~tV}tU~uV~tU}tU}tU~tU~tU~uV~tV}tU~uV~uV~tU}tU}tU~uV‚xY‚yZƒz[ƒz[ƒz[…{\„{\ƒ|\„}]…^„}]„}]„}]‚{[�y\~wY}vX}vX}wY~xZ~vY€vYuX€wZ€wY€vY�wZ‚y\‚y\‚y\ƒz\ƒ{^…a…`„}_€z\‚|^†€b†€bƒ|^ƒ|^‚|_soRpkQrmSupV|x[ƒ~a‰…g‘Œo”�r“�q‘�o’Žp‘�o�Šm†‚b~{Y{yWytTwrRytS}xW}wV}vX}vZ}wZ}wZ}vX}wY}vZ}wZ}vX~wYxZ€z\�{[�{[�{Z~xZ|vXyrTwqSvpRulUsi[vj]wnb�wk�…{�“ŠЋŸ—ЗЎЅТНЕЮШПвЯФддЪбгШХЩРЗМВЅЉЂ—œ•‘•�‚ˆ…syxw}x”™�šž’ І›ЊЏЇБЗЌЙНЖУЧРШЭХЬвЧШаХЯзЬембдкЭбзЪХЪОСЧМФЩТЖЛГЊАЅЇЃІЌЁŸЃš–˜�ŠŒ„…‡€‚ƒ†ˆƒŠ�‡‰ŽŠŽ’Ž“–“—›—™�™˜›—˜›•”–‘�ŽŠ‹‹‰‡‡…‡‡…ŠŠˆ‹Œ‰†‹…†Šƒ‰�†�’�”•�——�œœ“ЅЅžЊЊЂЏЏЄЖЖЌЖДЉЙЗЌЙЖЎКИЏКИЙЗЈА›Ђ �›™‰—”ƒŠ…tyh€xg|tcyqavo^um]sl[sk[rkZsk[rjZqiWqkZqkZqk[qjZqkZqjZpjZqk[qjYrjZsl[um]vn^vn^sk[ngVldTiaQf^NbZJ]VF[SCXQ?WO?UM=UN[RC[RC\SD]TE]TD^UF_VG`WG_VG`WH\SCZQ@[R?[RA[RA\T@]TC\SB]UA]UA_VCe\Id[Jf]Li`OjaPofTriWtkZwn\wm\xo[xp[woYxoZxoYxp\xpZxoZxoZxpZxpZxpZwoYxoYxoYwoYxoYxoYwpYwoYzo\xp\tp\qjZlfUgaQgaPe_OgaQkeUpjZtn]up^qkZkdTaZJYSCUO?SM=YTC_XHe^NkfVtq_qn_kgVfaQhcRibUgbTg`Sc]Oe_Qb\M`XIaYKbZJd]Me_Lb_IZY@VT=2A?2DB4D@2>=0BA2GE6HF7FB4KF8KE6JD4JD5MG8RN>TP@SO>RM=PL;OL:NH8LF6ID4IC3KE5NH8OI:OJ9PI:PJ:PJ;QK;QK;PJ:LF6LF6TN>XRB]VF`[Jc^Mc^Me`Oe_Md`N`\KYRBTM=TLSKUN>UM=UN>TLRL=SL=SM=QK;QL9PK8PK7PJ6PK7OJ6OJ6QK7QL8OL8OM5OJ6OJ6PK7PJ6QK7SO6TQ6SP6SP6SO6QM6OK4MG3OG4KF2KE1OI5OI5NI5NI5RM9RM8QM:SM9TL9WOYT=WT:UR8SN8OK6LH3JF0GD-DB*??%?>&B?,D@-D@-B?-@>+?=+==)?>*GB1JE4HE4GE4GC5HD6HE3GE3ED2CB.BA-BA/A@.@>.?<+?=*>=+?>,>=+<=-;<,99-78,68,68-67,67,57+57+45*34(34(34(34)45*67,79/79/89079/89089/88189289288178178178178178178188178178189089.79/89088189/89079/79/78199289289067056/78/78178167056+45)46*57-56+46,45,45.56/56/6607818929:39:3::3781881:;2;<3;<5;<59928:078/68.68.8909:/99/:80::29:19;19929:3::3:;4;=3<>4<=6;;4;;4<>4<=6=>5=>5=>5<>4=>3=?3=>3<>1=>2>?2>>0?=0?=2?=5==6==6>>7==6>>7>>7>>5==4==4>>5>>4??3??2?@2@?2=>2<<2>>3=>2>?3>?2>>2>?2=>2>>2==/?>1@>1@?2?>1@>1?>1>=0<;.==1=<0=;0;<0::.9:.9:.9:.9;.9:.68,68,67+45)31&01%..$//%//&.-(--'//(/-'-,(..(11*22+00)-.'--&((!((!**#)*#**#))#))$))#))!))#**#**#+,!-."+-")* ()'('))**,!*+ )*())*,-!-.",.",/"+-!)* )*()&&%%#'%"&%"'�'�''#(($*)&)(%))%,+(,,(**&*)&*)'*)'('&''%('%(($('$(( ((,,%..&..',,$*( '' &&%%&& ((!++$**#**#++"**"++"++"**"**" */4&(*!%) $)"%*"%*"%+"%*"$*"%*"%*"%)#&+#&+$&*#%*$'+$'*#&*%'+'(+%'*;>E\cm57; !#+-2-,,"""[ZZЖЖЖБААЌАГЋАЕЋАДАДЋЏДЋЏДЋАЕЌБЗЋАЖЌАЖЊЏЖЋЏЕЋАЖЊЎДЊЏДЉЎГЉЎГЊЎГЊЎДЉЎГЉЎГЋЏДЋЏЕЋЏЕЋЏЕЋЏДЌБЖЌАЕЋАЕЋАЖЊЏЕЋАЖЌВЗ­ВЗЌБЗЋБЗЉЏЕЃЉЎ ЂЅ™™˜‘‘Žусоџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщэьсццяѓѕіјљ№ѓѕфчьмрчйохйохинфзнуиохинфзнфелузмфйохзмфжлуинхинфзмуинфинфинфзнфжмужлужмужмфжмфзнфжмужмужмфиохйпхйпцзнфжмужлуектдкуинчV[h!%77;J67>!$#')(,0*/3+/4+/4*.3*.3*.3*-3*-4+/6(-3(-3*-3)-3+.3*.3)-3)-3(,3*-2*,1 mqfmpckodimiilfcge^dfZ]aRW`FLR:?I28B-3>%,9%,:*1=-4C16E6WSBZVE[YJ][L_]Na_PcaRcaRcaRb`PcaRXVGOM>NL=KI:IG8JH9JH:KI:JH9HF7HD6GB3GA1GA3GA2GA3FA1FA1FA2FA1D>0HB3PJ;RK1B>2C?1HC5MH8PJ;MG8LF7JE2IE2LH7NK9LI8KG6LG7LI7LG7MH7KF6ID3ID4LF6NH8NH8OI9PJ:OI9OI9OI:PJ:OJ9UP?YVD[WE]ZHa\Kc^Me_Oe_Oe`Ob\L[UEUM=RK;SLTLUN>UL>SK=TL;RN8RN8RM9SM9RL8QK7OI7OJ7OI9OK8NJ6MI6MJ4KG4OK8RO;TP?SO;TNWR=TN:PL7LJ4GF0FE1IH2FF0A?,>=+@<+B>-@>.=;*;:(::)=;+EB1FA2FB2DB2GE5GF4GF4EE0CC.A@/AA/A@.?>,>=,==)==+?=+@?-=>,<=/:<,68,57+78,78,67,57,67,56+23(24(24(34)34(46*67.89.99289078189288167266455355.66066/66/55.66/66/66/77066/66/77088188/88/88088/88188188177188177077077177077067067056+45)34(34)56+57+66-66/8928:4791882881881881881881881881881881:82:82:80:80:82:809:.:;/8:.89-89.88.970880:<2:;0:;09:.89-:;/<:/<=1<=1=>2<=1<=1<>2<>1=>2=>2<=1>?4<<2;91;92<:2::39:3::38:1992::3:;4;<2:<0;;1<<29:1991::1::1991::0::/;:/99-9:.9:.9:.9:.::.9:.9:.:;/<<0;;/;;/;E\cm46: !#+-1,,,"""\[ZЗЗЗВВБЎБДБЗБЕЌАДЌАЕЌАЕЌАЕЌБЖЌБЖВЗЎВИЎВИВИЋЏЕЌАЖЌБЗБЖЌАЕЋАЕЋЏДЊЏДЌБЗВЗБЖЌБЖЎВЗЌАЕЌАЕБЖБЖБЖЌАЕБЖЎАЕ­БЖЋЏГЊЎГЄЉŸЁЃ›š—‘�Šфтнџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщььсццяѓѕіјњ№ѓіфчьнсчкоцйохинфиофйохжмузнузнфжмузнфзмфжмуиохинфзнузмузмуинфжмужмужнфжмфзнфжлужмфзнфзнфжмузнфкрчкпциохжмфжмуелуекфинчUZf $67;I56>!$"&)).2+06)-3+05*/4).4).3*-3+/5+/5*/5)-4*.4*.3*.3)-2*.4)-3)-3(-1'+. npfnocmpglolloifjj`ehZ]cQW_EKS:?I3:D07A)0<&-;'/=(/?+2B18I8?RAH\OSk]_{ehƒmrŠuz“~‚š‚„ž�„œ€ƒ˜ƒ–~€’w|ƒpu|ilpbff[`bY^XZ]X_b\eg\fh^dfZcfXfh\jiYnl^qo]spZspZpoTppQooQxvYzvYywWwuSuqRwrQvpMwrPvmMsjGtnNvuZzx]wtWwtSwsTuqTtpRuqRtpStpSupSvrUvqTvrUvqTuqTuqTvrSvrSvsSuqRwqQwrPvqPvpOwqPvqPvqPvqPvpPvqPvpPvpPuqPtpPtpPwtRvuRvuSvtRvsTxuUxvTwtSwtSxtSxuTxuTxtSxuSywUwvSxwTxuTyvSyvTyvTyxTywTyvSxvTwvSwtSxtSztSzuTysSytSysUysUztWyrVxrXxrVzsWysUztVzsUysWysWzsYyrXxrXysWysWysUytVxsUyuTzvUyuTyuUyuTxtSyuTzvUzvUzvUzvU|xW|xW|xW}zY{yW|xW|xW}zY~{Y}zY|xW}yX~zYzvUxsSyuT{vV~zY�|\~zY€|[~|Z~zY~yWxW~wV~wV}vU~wV~wV~wW~wWwX~xX}wV}xW|vUzvU|vU~xW}wV|vVzuT|wV}xW~wX~wW~uV~uVuWuWuV€wXvW~uV~tU}tU~uVvWuV{rS|sT{rSzqRzqRyoQxqQxqQxqQxnPzqR|uU|uU~wW€yY‚z]‚{]‚z]„|_…~^„}]ƒ|[‚{Z‚{[€y[~xZ~xZxZxZ€y[y[}y\|w\|x]|x]|y]|y^|y]}y^}z^|y]z_€{bz`�|b‚}c‚}d€{a€{`~y_{w]{w]zw\xtY}{\†„e��qš˜yЋЉ‰МКšЧХЅЧУЅШФЇЪШЊЫЩЋХУЃИЖ™ЉЇ‡�›|”’q‡ƒezvWsmOmgKkgJkgJmiJqkMsmOtnPslNtnRuoQvpRwqUwqWyqWzr\xp\xo[wo[tlXsjVofXphYvl`�uk‡{rŽ„y“‰–�‚“Œƒ–�ˆš•ŒŸž’ЇЄ™Ќ­ ДЗЊКЛЏИЛЌАГЄЁЅ˜’™Š�’„�Š}t~pr|o€‰€ˆ‘‡’œ� ЉŸЈБЇЕЌДЌДЋЏЖЎЎЕЌЏДДЙБЙОЖЕКГБДЉЌІЂЄ� Ђœ˜š”‘“ŒŠŒ…w|rotjothjrefkadkcgnglrjnumkrjotjw|rv{qtxqruprvpqsmsumuwovwmwxnxyszyu}{w„€}ˆ„�Š…�†€”�‡—’‹ž˜�Ї ™ЎЈŸЖЎІЛГНЕЏПЗБРИЏЙАЃЅ—ЄœŽš’ƒ�†w‚|kysbnhWg`ObZJaZIc[Ke]Md\LaZId]Md]M`[H]XE[UC\VD]XEZVAZVAYU?YUCXTCXVG[YJ\ZK][L_]M_]N_]N_]Na_OUSDKI:IG8HF7HF7HF8KH:JH9KI:IG8IE7GB2F@1F@1E?0F@1FA1FA2E@0E@0D@0HB3OI:QKJJ:DB7?>1@?2@?4BA4FE6JI<-><-C?1HD6KF7KF7LG8KE5JD5JE5NI8OL;OL;NI8LH7MJ8MI8MH7JE5HD3HD3LF7PJ:OI9OI9PJ:QK;PJ:PJ:NH8OI9UP@XSCZWE[XFa]Kd_Nd_Nc]Mc^Mb]L\VFTN>SK;RJ:OI9NH8PH8RJ;VN?YQA[SCZRBXQAVN>TL=RK;PH9LF7MG7MG7NH8MG8PH8RK;TLVN=UMRL:RN9RN9SM9SM9QL9PJ8NI7OJ8NI7NJ7MI4LI3LI3LI3NK5RO;SO>RMSO-C@.@>-><+<:);:)=;+D?0FB2FB2DB1FD3GE4GE3DD0AA,@@.A@/@@.@?->>->>)=<(><*??+>>,;;,99*78,78,78,78-67,57+67,46+45)24'24(34(45)56+78/78-77178/66/77067066166466466/55/55.66/66/66/55.55.66/55.66/77077077077077077066/77077077077077077077077.77.77.67.56+46*45)57-46,56-56-66-890792781881881882881881881881881881881:82:82:80:80:82:809:.::.9:.8:.8:/88.88/9909;18:089.9;/9:.9:.9:.;<0<=1;<0<=1=>2=>2<>2<>2<=1<=1>?4;;0::0991991::19:19;19:0890::3::3:;2:;2:;0;<1:;1:;1::1::188099/88.99-9:.99-99-9:.99-9:.9:.::.::.;;/;;/;<0;<0;;/; #"&)*/4*/5)-3*/4+/5*.4)-3)-2*.5+/5+/5,06+/4*-3*-3*-2)-2*.2)-3'+0'+. oqenpdnpglnnlongko`emZ]eSXbEJT9?J4:G17B*1?&-=*1@*2A.6D3.D?0D?/D?0D@0D?/C?/HB3PJ;QKQQ>UTBYYF^]JdcPkjWkjWon[qp]rq^po\nmZfeR^]JYXEKJ=BA5?=0A?2@?4CB4FE8KJ?ML?HG:=;.20%20%21$32%43(64(65&54'76)75)76+880::1<:287-65+54*53+53,31+0/)00)//(//(22+33,22*31)31)13,13,34-43/55.44+22*20(23'21&20%2/%3/%30%3/%2.$0,".* -*!.+&.,'/-'-+$.,&1/)1/)/,'0,'/,'.*%-+#.,$.-".-#*+()+, ./#23'45)87*98+<:-?=0GC7IE7IE7JE7IC5IC4ID4MI8RM=QM=PK;NI9MJ8MH7LG6JF5ID4HD3LF7QK;OI9OI9PJ:PI:OI9PJ:PJ:QJ;RMSKXRBZSCZRBYQAVN>TM;RLVO?VO=VN>SLVN@TL=SK=QK9QK7QK9RL:QL9OI7OI7NH6OJ7OI7OK7LH5JF3JF3IE2KG4OK8RN=PM;RN;TP=VR?YS@YS?ZVAYT=XU?VS?SQ;RO9PN:NL7MK6HF2DB.A@,A>-A>-A>-?=-=;*<;*><,C@/D@0D@2DB3EC4EC3CA3A?/??-??-@?-@@*??)=='?>*>=)>=+??+>=,:;+9;)89-68,78-67,67,67,57+56*23(24(24(23'35'56+68.67,55.66055.66/66/65165466266/66066/55.66/55.55.55.55.55.55.55.55.66/66/55/55.55.66/66/66/66/66/66/55.54066/55.55.35+13'13'34)47+57-5506727917919:1881882881881881881881881881881971:82:81:80:82:809:.:9.8:.9:.:;089.8808908:079/8908:.89.99-:;/<<0<>2;<0<=1<>2<=1;<0;<0<=1<>2>?3;=189.9;0:;09:/9;/:;19:09:08929:19:1:<2;<2;<38909:18:09:09:/9:/99-89-88.88.88-88-88.88-88-88.88.::/::/;;0::0::0;;099/:;/;;/;;/:;/:;/;;.9;-8:,8:+79*79*88)99*67(45%33$12$11(00*//&--&..'..'..'..'..'--&..'00)11+11*//(++#((!))",,%,,#--$--'//(//)11*//(--%,,$,,$//&00)..',,%**#**!++#**#**$++$++$))#**#))#++%++#,,",-!-."-."-.",-"*,#)+")*!'*&(&'&(') '+!(,"),")*!'(%&%'&(') &'%'%'&&)(*),+!,*",*"*(!)('%(&)()((&&%%#$"&%&%(')(*()( *.4%'*#&)#&*$&,#&+#&,$&,#&+#&*#&+"%)#&+%',$'+$',$',$'+#%)%'+&')&'+:=DZbl58; "$,-2.--$$$\\[ЙИЙВВВЎАДЌБЖБЕВЖБЖБЖБЕЌБЕБЖБЖАЕБЖЎГИВЗЌАЕЎВЗ­ВИЌАЕБЕЌЏГЌАЕЌБЕБЖЌАЖБЖЌАЕЋЏДЌАЕЋАДАЕБЖБЖ­БЗЌБЖЌАЖЌБЖЊЎГЄЇЌŸ Ђ›™•“‘Šцфпџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъэьтццэђѕіјњ№ёѕуцьотшлрчкпцинфинфимужмуиофиофжмузнфзмфзмузнфзмужмузнузмужлтжнужмужмужмфзмфзнхзмфжмузнфиохипхйпцйпциохзнфжмуелуекуекфTYe"'8:=J56;!$!%((,1*.4*.4+.4*.4*.4*.4*-4),3)-3+/6,06+/4).3)-1)-1(,1)-2).3'+0(+0!mocmmbnpgnqroqrimpbgn]aiUZdGMW:@[user]K37G06C[/user],1A+1C/6H-5F08H5=P;CWAH\KQf[_wimƒptŠv{‘}�˜‚…œƒ†›�†˜„“|‚Žv}†qw€iosaeh\`cZ^Z[\Y_aZce]ce\ce[deYeg[hhXmk^nm[poVonWnnRnnPooQusWwsVwtTurQtpPtnNvpMysRxoMvnHuoOutaxuaxtYwuSwsSurRupRtpQtpStoRuqTvrUuqTvqTvrUuqTvqTvrSvrSurSvrSvpPvpOvqPvpPvpPvpPvpPvqPvpPvpPvpPvqPvqPuqPupPtqPtrPtsPsrPtrRvsSwtSwuSwtSxtSwtSwuSxtSxuSyvUxvSyxTxuTyvTyvSxuSwvSxuSyvTxuTxvTxuSytTzuTzuTxsRytSxrTztVzsWysVxrXysWztWysUzsUztVztWxrVysVyrXxrXysVxrVxrTvrSvqSwrRyuT{wV{vVzvV{wV{vVzvU|xW|xW|xW|xW}yX|xW}xX}yX}yX|xW}xX~zY~yY|yX}zY~{Y{wVytTxtSyuT|xW}zX|yW|zX}yX}yXyX~wWxW~wV~xV~xW~xW~xWzY~xW}xWzvUzvU|vU{vV{uUztTzuTztTzuTzuT}wWwXxXvW€wXvWvW€wX€wX€wX~uV}tU~uVuV€vXvW{qSypQypQzqRzqRyrRzsSzsS{tT{tT{tT{sVzrU{tV}uXwZ‚z_‚{_ƒ{^ƒ|\�zZxXxXxX}wY~xZ€y[€y[y[y[€z\}y\{v\{v\|w]{v]|w]{v\{v\{v\{v]|w\z`�|a�|b€{`z_|w]ytYwsXtpVvsZyv]{x^�€d‘‘tŸŸ�АЏ’ИЙ›СТЃЧШЉЪЫЌЯЮБгдЕбвГбвГЮЮАХХЈДЕ—ЅЄˆ–•y‡…j|z^wtYjhNcbGgeKnkQmhOmhOniOmjOojPpkOqkOsmQwpTysXwpXwpYvoVslUrjTqhYvm_~sg„umˆ{p�„x’†x�ƒwˆ�uˆ�xŒ‡|–“‡ž™ŽЅЅšЏБЄЕЕЊИЙЌИКЌАГЅЁІ——žŽ…�€x�sw�u�‰€…�ƒ�•Š•ž”™Ё—šЂ™™ —–�”“š‘�”Œ�•�•™’™œ–˜›••™’‘”Ž��‰ŠŒ†ƒ…}xxzsqtnmpjimfcjb]c[Y^XY`Y[bZ]e][c[Y`XZ`Y\b]dheknmknjhkdikcjlanncsshvvo{yu~|x�{x€{x„yŠ„�ˆƒ�Š‚’�…˜‘‹›•ŒЅ�•­ЅŸВЊЄИАЊКГЉЕЌ Љ “Є›ŽŸ–‰”�…q{ugoj\c^PZSHVODXQDXQDVPASM>TN>SN;VP@WQAWRAWRATP?RN=RQ>WTBYXEXVGXUFYWH[WI\XJ\ZJZXIXVFWUFXVGLJ;A?1B@1B@1EC5HF7JH9KI:KI:IG8FB4C>0@:,A<-B=-C=.D>/E?0C=.D?0C>/GA2OI:RL=VQAWSCXRCWQBUO@UOAVPAXQBWPAWO@UM?WN@VN@WO@YQC[SE^VG`XId\MjbSkcTlcUnfWpgYsj\vm_xpa{sd~vg~ve|td{sayr_vo\um\rkZpiXphXohWphXxq`|tayq_zrayqazrayrbyq_yr_zr`wqasr_qp\mlYkjVmkXpn[sq^us`vuawubrp]kiVihUgfSfeRhgTkjVmlYnmZnlYmlYkiVfeR^^KUUBPO=ML:OO1@?2?>3A@4FE8MK@POBLK>@?232'10%21$31%43(64(65&64(65(65(86,880880;:076+54*64*75+75.53+31*11*11(22)42*53+22*33*22)12+12)45+55.44.44+33)22)23%31%32%31$1/#3/#3/#2."0,",* ,) -+#.,&-+%.,$.,'1/)1/'/,'/,'/,'/,'0.(0.(.,"-,"))'(+, -."01%02&45)67);:-?=.DB3HE4JF6GD3GC3FB2GB3MH9SP?RN=QN=NK:MI8NI8LG7JF5JE4ID3MG7PK9PJ:PJ:PJ:PJ:OI9PJ:OI9OI9QK;SN>UQ@XUC\YG_\Ja\Ka\K`YI_YIWP@RK;RJ:QI:NH8NG8NF7QI:TM=YQAZRBZRBYQAWP@UNUN>VN>WO?WO?UMQI=PJ:NI7OJ7PK8PJ8OJ7OJ8LG5KF4LG4LF4JF3HD1FC0EB/GF2KJ6KI9MJ9QL;TP=VQ@VP@VP>VR>UQ:WT>WVATS?SO,>=+=<*>=+><+=;+=;+@=-A>.C?/CA2CA1CA0B@0@?->=+==+>=+>>*==)>>*@?+??+??,@@+=<+;<-;<*99-9:/8:.79-89.79.67+46*13'/0%01%01&23(57+78177.65155.54066165155054166266/55.66/55.66/66/77066/55.66/55.55/77066/77066/55055.66/77055.55.66/77066/88177077066033+23(23'24)56*67.5618838928:0992971881882881881881881992992992981:82:81:80:82:80:;/:8-99-:;/:;/89.89079/7909:179/78/89.89.;<0=>1<=1=>2<=1<=1<=1<>2=>2=>2<=1>?3;<09:.;<0;>1:<0;=1;=39;19:19:09;19:09:09:08:09:18909:0:;2:<0;<199/88.99-::.9:.99-9:.9:.9:-9:.89-:;/:;/;<0:;/;<0;<0;<0::/::0::/::.;<.:;-:<-9;-7:+8:,8:+89+89+78*67'33$22%11(00)//(--&..'..'..'--&//)..(..'00)00*11*//&++#))"**#++$++$++%,,%..'..'//(..'--$--$**"--%..'--&--&,,$--$,,#++$++$))"((!%%&& ((!,,%,,#--#-."..$..$--#-.#,.$+.$(, '*'*&)'*(+(*!'+!'+!(* &)%'%(')(+')$'#&%%*)-*!-,!,*",*#+(!)( (&(')()'(''%&%%$&%'&('*)*()( '+1$&)#&*"%)#%*$',#&,#%*"&*"$)#&+#&*#&+%(-%(,$',#'+#&*%'+$&+%&)&(,;>E[cl37: !$,-1,,+"""\\\ИИЙБББАГЌБЖЌАЕВЖЌБЖБЖВЖЌАЕЌАЕБЕЎВЗЎВЗВЗБЖБЖЎВЗЌБЖЌАЕБЖЌЏГБЕБЖБЖЌАЖЌАЖЌБЖЋАДЌАЕЌАДЌАДЌАДЌАЕЌАЖЌАЖš Ї…‹”‘•�ЁЄЈŸ Ё›š—“‘‹чфпџџџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъэьуцчюђѕѕјњ№ђѕхшэнтшкохйохйохжлтзмузмузнузмужмтзмужмтзнфиохжмужмужмузмузлузнхзмфинхзмфинфзмфжмузнфзнуиохиохйпхзнхжмфжмуелуекуекужкхUYd#'8;?L67<!%!%)(,2+/7*.4+05+/5).4*.4+/7*.5*.5+.5*.5*.5+/4*.3)-1(,1'+2*.4(,1(*. kmakl`mohlopmpqgjp^dkY^eSYbINX:>M04D-3B,1B*1C,3C,3G08I3;N8AV@H[MSj]bzim†ou‹sy�x|‘~�–�„—�†—†”{€�s|„mviouchk^cfZ^][\\^a]ad^`d[acYbcWceYggYkk_ml\onTnlUooTnnNomOsqUtqVtqUtqTsoRtmQvpRyrTzpQxpLvpRvuayuaxuYvsRwsRurUtpSupSuqTsoRuqTvqTvqTuqTvrUvrTvrUuqRvrSusSvrSvpPvqOvpPvqPvpPvqPvpPvqPvpPvpOvpPvpPuqQuqPuqPtqPtsPsrPtsPusSwtTwtSwtSwtSwsRwtSxuSwsRwtRyvTxwSyxTxuSyvTyvTxvSxvSxvSywTxuTwvTxvTyuTztTztTysRysSxrTztVztXxrVyrXxrVzsWzsUzsUysUysWysWyrVysXysXxrVyrVyrUwsTvrQwsRyuUyuTyuTyuTytTzvU{wVzvVzvUzvUyuUyuTyuTxtSxtTzvUzvU{vV|xWzvUyuT|yW|zX|xWzuUzvU|xW~yY~{Y|yX{xW{xV}yXy[}wYxX~xW~xVyX}xV~xW~xW~xX{wV{wVzvUzvU|vV{uTztTysSysSysRztS}wVxX€yY€wX€wX�xY€wX‚xY‚yZ�xY�wY�xY€wX�xYƒz[�xY}tU|sT{rS{rS{rSyrRzsVzrUzsV|tWzrUyqT{sVyqT{sV|tW�y\ƒ{`„}]ƒ|[�zYxX~wWxX}wX}wY|vX}wY}wX|vX|vXzvYzu[ytZxsYytYzuZytZxsYytYytYzu[}x^z`z`z_~y_|x]wrXvsXspUurW|y^€~cŒ‹nšš|ЅІˆЊЋŽЊЌ�ЌЎ‘ВД–ЕЗ˜ЙМ�ПТЂМП СУІФШЋПТЈДЗ�ЅЇŽ•–€‰‰r€€h}|irr\jjTjjUonWpnUplRpmSpmSspUtpSrnQrnOuqRupSsnUvqXtoUqlUupXyrcyi€xk�tkˆ|rŽ„x�†z‹ƒv†t…~uŠƒ{’�„ž™�ЅЅ™ЌЁББІЖИЋЙЛДЕЈЉЌ�™ž�ˆ�€y�ty�t‚‹�†Ž…‹“ˆ�˜�”�“•œ”‘˜��’Šˆ�†ƒˆ€ƒˆ€ˆ‹…‹�ˆŒ�‰Œ�‰ŠŒ†‰‹…ˆ‹„‡‡‚��|{|vkmgce`ad_^b\]d]`d^ZaZW^VT[TRZRT[TV\XV\X]a]deddecde_iibooeushxujvtnwsp~{w~yvzw„z‰ƒ~Œ…€�ˆ€’�…–�‰”�‡�•�ЇŸ™ЎІ ЕЎЅИАЇВЉžЇž•�“‹—�…Ž‡~„}sytilg]`[QZSIUNDUNCWQCUOARL=QK;RL/C=.HA3OI:RL=VQAXSCXRCWQBUO@UOBVPAXQBVPAWO@VM?VN@VM?XOAZQC\SE^VH`WId\MjbSldUofXqiZtk]wo`zqb|sd~vgwh}ud{sbyq_vn\tlZqiYogWohWphWqiYrkZyqa|tc{tc{sc|tc{sczsc|tc{sc{tcyrbtr_qp]on[nmZpn[qp]ut`utautavtaqp\ljWljWljWnmZqo\us`ts`sr_pn[mkXhfSaaN[ZHTTAOOUQ@WTBZVD_ZI`[Ja\K`\JZUDSN>QL;OJ:LG7MH8NK:PM;RO=WSBXTCWTBVSATQ?TP=RN;OL:LJ9MK9LI8MH7KG6MF6OH8PH9RK;SL,<;)=<*?>,>=+>=+?>,>=+>=+>=+=>*;<*9:*88)68,78-79.68,67,67,56*34(12&/1%01&23(34(46,67066-55065155065165154056266177177056/56/77078167088267066/66/55/55.66/54065166155.66/77055.77088199288188088/88077.55*34&24%35'48'58)58)7:)6:'5:(68+78.770770770881881770771881992:82:82:80:81:82:81:;/:;/::.9:.9:.89.78/79/7907817818828908:/:;/<>2<=1<>1<>2<=1<>1<=1<=1<=1<>2=?3<=2<=1=?2>A4=?3=?3=?5:;19:08:08908:08:08:08:0:;2:;1:;1:;2;<2<=3::088.88088088/88/88/88077/88/88/991991::2::1991::2::1::/::1::0;:09:.99,8:,89-7:-89-78,79*89+78*66)34&34&22)22+00)..'..'--%--&,,%00)00)//)//(..(..'..%,,$++#,,$--&++$**#**#++$++%--&--&--%++#))!,,$--',,&,,%--%,,$,,%++$**#))"((!%%%%((!,,%,,#--#./#.-#0.$..#--$+-#*+"() '(''&&((())+!*+"*+"*+"(*&'$&&''(&'$%#$$$+),*!+)!+)!+)!(&(&(')()(*()'*()' )' *(,* ,+!,* ,* +*  (,3%'+#&*#%*#&+#&*#&*"$)"%*#&*$'+#%+#%*#&*%',$&,#&+$',%(,%&*'(*%'*J04D/5D-2C*1C*1A,3G19J4;O8AV?G[LSj[azelƒpu‹uz�y~’}�“~‚”�†•†”{‚�rz…lthnudil_diZ^^X[\\_^ae^`c]ae\cdZce[deYgh\ijYkkRmmUnmQnnNomOspUtqVsoUsoRsoRunQwrQysUzrOyrIvqPvt_xuaxtYvsRwsTurUtpSupSsoRtpSupSuqTuqTvrUvrUvqTvrSuqRvqSurRvqSwqQvpPvpPvpPwrQwrQwrQwrQwrQwrQwrQwqQvrQvrQvrQurPtsPttQvtTusSvsSwtSwtRwtRxtSwuSxuSwsRwuSyvUwvSywTxuSyvTywTyvSxwTzwTyvTxuTxvTxuSxtSzuTytSytSysSyrTzsUztWysWxrXysWysWzsVysUztVzsWysWyrVysVysXxrXxrVxrTxtUvrRwrRxtTyuUyuUzvUzuUyuTzvUzvUzvV{wVyuTxsSwsRxtTxtTxtTxtSxtSytTyuTxtSzwV|yX{wVzvU{wVzvU}yXzY{wV{wV{xV}yZ~x\}w[}wX}xW~yXyXyY~xW}xW~xW}xWyuUyuTzvU{vU{uUysSxrRxsRytS{uT|wV~wWxX€wX€wX�xY€wX‚yZ‚yZƒz[‚yZ�xYƒzZ‚yZ„{\‚yZ|sT|rS|sS|sT}tUzrUzrUyqTzrUzrUyqTxqUxpSwoRwoRzrU�y\‡b‡€`„}\€yY~wW}vV~xW{tVysUztVysUxrTxrTztVyuWxtYytZytZytZytZytZytYytZytYytZ|x]~{_~{_~z_~z_|w\{v[ytYtqWxu[‚eˆ…k‘�r——zœ��œ€š›~—™|—™|˜›|ŸЁ‚ЉЌŒЏ�ГЕ˜ИКžЖИ�БГš­Џ•ІІ�šš„““{��w‚‚lxxbrqZroXokTpkRplQpnStqVuqTuqRrnOsnPuqTtoUspVqnTpkRupXzue‚}l†qŠ}v�ƒ|‘‡|�…{�…z‹„{Ž‡‘Š‚˜–‹ЄЁ–ЎЏЃЕЗ­КМЏНОВПРГИЙЌЋЎ › ‘‹�‚}„wx€s|ƒ{}…|‡|…‹ƒ‡Ž†‰�ˆ†‹ƒ„|x}uqvnnrkptmuyrz}w{}v{}v||w}}x{{vwvqqrlijffgcbd_^c\\aZX]VSWQOUNNUMNUNRXSV\WU[XX[Z\^[bca

[Ei aihetta]Torstai 16.03.2006 14:11

fr opp ki nnu zs uui dds rh ac ci ik ox aea bbbb jl qo eer nbn x ww td aab uuz vcc ro fd rf vvc zo fg p sx mm ipp lkk bnn sz tf yp yyy hhh yt xz ks yiy vvv ck ni ssa yzz cxx bf gaa csc qqqq pop fb bv fs ere ba tr llk bab uzz di sdd xoo cvv ub llll heh xcc sv uu eww uy rt zi yo za wa ghg eg gs j us mmm iyi ha cck sc jj dd cb uf kl qqo hg va nun poo mnm cd ss uun ux eh hf we gj hgg vvb zzy nv zx kh ef hhe fh gh ft ie es klk ve hhg nbb sss vf ao t tttt um an gg lc mmu icc is az ei ii lll e oy eff ti baa yty my tdd ee ckk xv fff sf ew im te zuz wf iui sas py vfv io kv xc ehh szs sd cu kc iu nm vc ej bb bs xxxx z as bbb ckc jjj se c cs kk al oox wwww in nmm jk mu ge wr dz mmmm lkl pe oio iy ssd hhhh iiu yn aee rrr vn vv yyyy da op dud bvv kkc qqq zzz ca vs fa ix oop iip zzx zsz xzx bnb cci aag du oh ea mmn ga ooo gf dddd uuuu fgf pip ttt xs le oz oq sa uo m kjk zc dr hr ry eee ppi ewe fdd oc eea q err uc a ttr ty cl yr tz xxo tt bu cc jjh po eb zy ooi fee zt uii su ddt www je ccc vx v ah re un hh ytt ed vbb iz lla iv fgg mnn uiu eoo oii ak dv vk dtd gggg dt ds nnnn hj nb eaa dy cv oa ioo vi gd sds wee yii k nn ffv uuy yyi lk ll eo qp ka trt fv jkk oee kj mb uud uum ar szz fdf lal duu scc ep udd jjjj dfd xxx ts ddu hjh nnn rre b it wqw scs kkk fw f ui pii aae kkkk yyu ioi jjk wew gv ys rer gga qi kll cxc vff zuu all na gff aa rrrr laa xxc xxz hk lj iyy xzz et ffff h uz ccs wo fe xy asa kx bm opo bbn jc cz kkl ooe ae dc yyz jhh zzu ssss ym mum s bba o nmn vvf dsd yc bn cvc er pi yuy ou ssz vcv id ppp ff cic trr rd ghh jh fvv ggg muu rtr u ccx iio ip y bvb or tty ttd xu oe sb ffd ra cccc pu zxx yuu fef yx ad ow co dtt ass rw xox ssc vb yu de i he eef xp up oo qw qqw sk iq eq iuu af xx ffe pq yz tyt zyz zss ggh umm xi mi d cii iiy yy pp bbv kkj aas wh hgh fvf aal nnm hhj fc ab zyy rtt vvvv ny iic nuu kviz qwq qww tdt zz wq bc qoo ls ag of hee ho ic be vd pppp fu mn ut r sy aaaa aw n oqq oi hjj wwe eeo rrt l jg vbv sl kck sg fo g zzzz el ggf yi wwq kcc css la agg ddf gag ppo jkj st kjj dff rr dg ooq abb dss zzs zu qoq vg ud yd tu si cy eew yyt nnb xk hw xo jhj ree cf ev eeee zxz ccv tyy zd df saa cj qq eoe uuu wqq xcx gfg uyu unn cx qe px iiii ddd ffg uyy oooo av nu oxx aaa w eeh iii bbv zyy yyyyt aee aas hhh rrt bu tyi ak jh oxx tuu yuy re uy ppi xu cci iut wq cd el tdt ffg be dd f cc wdmuddhjs ytu cx rd iy tiy ggh yts zz al z yrrr yytt dg hw gv gf d sz ffff www iiyt ys llll eq yst op pii tyr ic ttyt ccs ryt yot q dv oe zuz ye g n pe vbv iu cy o tyyy nmn all uuy ssc bb fv ll zzy rry itr xs yn su fff sy udd heh nnm hee ir pop ki lal ie ox iv sdd mn is yyytt rtt ree cii qq itt ttty yx yur icc yi uuu hf wee ub mnm yo aab st sa ra kll wwww yyit vfv wew zxz x pt mum iiy fee ab yuu ttt vk ddf ipp qe ppp yry uyr yft cl yrd hj vg ooo qo muu iiii qqq kc ge eeee ah eew cj ddu ho jjj ga pu ghh py or fh iti irr eer fgf cvc yid un yddt iip nnnn zzu ue oqq yyt bba zt cf v ooq err ytyy im xxo nn cxx hg yte yyty e umm iui uun nv gggg gff csc ni rty yytd yyrr pi xcc s yyttt hjh yv mu fdf af yttr zzzz mm yre k jj ggg nnn kkj zx uf yyi abb yyrt dt ehh ydf trr pq aaa up ity lkl yfd yyut rh kv nnb ytrt yuyt uud yutt ft scc fs uit qqqq scs yc mb zuu px eeh an jkk xv xzz a nbn iyi ssz jl mmmm eea yyy ytd ru ro rr yrtt ae aaaa rre ttu iii av ytdt yys uiu opo ym ddt iyt id qoq uc di ou iyyt yydt iic yytr zd tu xx aw xc cb sd yrt ytt oq et urt ssss fvf tty td cic er vb we gg gh ydy yyu sss jhj vc uz ytdd yds dff ydd ooi oop bn ytty xo ew wf vs hjj iq zzs uuyt yrrt uuuu fe eeo ds gs ei szz xcx zi dud oyt oio qww vvv ao ccv du vvc wh jjk si ud ytr rer bm llk dr fd tf yyd yg ev vvb yuut va vcc sv tyu ccx vff w sc iyr nb mmm yf utd kx oit ww nnu pip in iid hhg iyd ik yye kkl ve zyz yyr fvv bab ot yyyd tyy mmn xi aa wr iit eh zu gga ar uyyt xxc irt yyyt eoo uty ggf oox yff iitt dtd yw yttd jjh uui xk lla yer iio tit wa dy ppo ffe vd ci bv za rrr se ri eo dty fdd oc uo l dyd cz ip he cs ti yzz wwq uii aag yud opp ddd co nm bf yyyy cccc hk tz m eoe sas pppp iytt ewe to je of pp aae eef ydu baa de tytt ccc po zc qw poo nmm ffv urr css bbb vi jc rrrr szs da laa yydd yd tr vcv vbb uut ey qi uum ed wwe yitt xxx ry gfg cck ryr fg kkk ckk mmu wqw u trt ix cv ka ya gd ioo dyt it xz tti ott zss ysd vvf kj fo ytrr mnn la sf oi if eb zy jhh ydr sk vvvv cxc zzz yu duu oh ux gaa jk yty ej hhj uttt ttr hgg ittt az sb try yr ydtt hh yit aal ls cvv yii rw y xxxx xxz io mi yiy yt oot xoo ur vv jjjj fef tdy my jkj yp oa ep lc rf vf fc ooe us eww ac tuy tttt dddd agg aea ytyt bs tyyt ckc ui iyy gag oz ffd sds xox zxx yyz yss iir nun yiit idd dfd ssa fa sl ny yir tut yrr ass cu ff iiit fw vn qp bnn dc ytttt ca kjj yddd uuz um ea yiyt hr iuu od ttd dyy unn utr tdd gj uyy h p ss yut yyyr qwq ts eee uyu kcc nuu ssd uyt lj oii nbb ut wo xzx ere zzx iz bbn ha saa eg oy tyd fgg fy ck tt lll yy uytt ef dsd hhhh nu xp vx fu ag utt wqq lk yti dss ioi ghg t itd ddy kl kk eaa ad eff uyd uzz iot zo uuut sg xy b uur tii yee dds kh r yyf ytf rt ee ydt yet sx ow ba bbbb ty dtt i bvv utu qoo fr zsz hhe asa j bvb lkk oo te kkc ryy tyt df as uutt iiu qqw le fb ks udt na qqo uu idt dz ii c yttt zs yz bnb jg hgh ttyy oee bc oooo es rtr wdmudduhjs wdmusshjs wwdmuddjjs wdmufuhjs wdmudejs wdmudtdhjs edmuddhsj wuuuddhjs wtmuddejs wsmudthjs qdmuddhhs wdmuddhc wdmdudjhs wdumddhjc qdmuddhjc wdmudddjjs wdnuddhjjs wfmiddhjs wdudhjs sa wdnuddjs emduddhjs wfmuduhjs wdmmutdhjs wdmufdhja ddwmuddhjs wwtmuddhjs wmudthjs cx wdmudjhs wdmuddjjz po wdymddhjs wdmuedhjs wumudfhjs wduddhhs wdmiddhs wdnuddhhs wdmutdhsj eduddhjs wvmuddhjs wdmudhtjs wdmuddjhss wdmutdjs wdududhjs ewdmuddhjs wduddhjd qdmuddhjjs wdmidfhjs wdnmuddhjs umuddhjs wdmuddojs wdmudgdjs wdmudfhhs wdddmuddhjs mduddhjs qdmudthjs qdmuddhs wdmufshjs wdmudtjjs wwsmuddhjs wdmuuddhs wdmyddhja wdmuddhd dwmdudhjs wdmudjdhs wwdmuddhs wmusdhjs wdmmudhjs z oe wsmyddhjs wdmmuddjjs wdmmuddgjs demuddhjs wdmsudhjs wfnuddhjs wdudhdjs wdmudddjs wumuddhs wdmidhjs wdmuddhjzz wdmudfhjz wdmuuddhjc qdmutdhjs wdmmyddhjs wdmuddjhs wwwdmuddhjs wtmuddjhs wtmddhjs wuddhjs wdmddhjd dmdudhjs sz wdumdhjs fmuddhjs wdmutdhhjs wdmudffhjs zx wdimddhjs wdumdshjs zu wwdmmuddhjs wtmuuddhjs wdmmdudhjs wmmuddhjs wdnudhdjs wdmufddhjs wdusdhjs wdmudhdjc wdmmuddhjjs wmduddejs wfmutdhjs wdmuddfjs wdmmiddhjs qdmddhjs oo wdmuddejc wdmuddggjs wdmuddhaj wmyddhjs wwdmudthjs wtmuddhks dwmusdhjs dmuddhhjs wduuudhjs dmuddhjc wduddjhs wwdmuudhjs wdmuddghjs wdmuddhz wdmdudhja wtmuddhjss wdmusdhs wmmduddhjs uy wduddgjs wududdhjs wdmuuddhhs wumuuddhjs wdmuddha wdmudhja wddmuddhs cc wdmudthjss wtmuddhjs wdmudshsj wdmddhjc wdmddhjjs wmutdhjs wdmuddhgs efmuddhjs wduddejs iu wdnyddhjs wmdddhjs wduuddhjjs wdmushjs ty wdmudddejs wmfuddhjs wdmuuddhjs wfuddhjs wdmudhdjd wdmuddgja wdmuddhsjs wuuddhjs wdmuudhjz wdmudthj wdmudsejs w wwdmuddhjc wdmisdhjs wdmudhdks wdmuudhsj wddmuddejs wdmuddhha wduuddhks wdmuddhhjs wdmoddhjs wdmuddjgs wdmyddhj dmusdhjs edumddhjs wddmuddhks wdumddjjs wduudhjs odmuddhjs wdmudtejs wmuddjjs wdmiduhjs edmuddhja wmduddhja wdmutthjs wduddhks wdmudfejs wdmmddhjs wsmuddjjs wduufdhjs swmuddhjs wduuddjhs u wsmutdhjs wdmydddhjs wdumduhjs wdmuhjs wddmuddhjs wdmmuddhja dmuddjjs wdmuddjsh wwdmuddhhjs wdmudehjs wemuddhjs wdnuudhjs wduuddhs wumudshjs wdmuduhjc wdmuduhks dwmuddjjs wmduddhjz wfmudfhjs wdmuddjjc wdmuduuhjs qdmuddhhjs wdnuddhjz edmuddejs wdmmudshjs wddmudfhjs wduudfhjs wfmuddhs wmuddgjs dmddhjs ii wumuddhja wdmuttdhjs wdmyddhhs wumudhdjs wtmuddhjjs wdumddhjss wdnuddhjd wdmiddhhs wddmmuddhjs wdmuddej wdmuddhjss dwmuddhsj dmuddjhs dwmuddhjz wdmdudhjz wduumddhjs wfmuddhjd wddmuddhjjs qdmusdhjs wfmufdhjs wmduddhjc wunuddhjs wduddhjjs wdmutdjjs wmduudhjs wddmuddhja wumutdhjs wdmuuddhjss wsdmuddhjs wsmuddhsj wdumdhdjs wdmufhdjs wdmusdhjs wfmudthjs qdmmuddhjs wdmdhjs wdumuddhjs wumuddjs eddmuddhjs wdmuddhjjz wdmutuhjs wdmuddgj wdmiddhjss wdmudedjs wtmuudhjs wdmutdhhs qw wtmyddhjs wdmudrhjs wddmuddjs wdmuiddhjs wduuddhhjs dwmmuddhjs iii qdmudfhjs wduuduhjs fd wdmudhfjs wsmuddhja wdmuddhsh wdmudthhs wdumdthjs wdmuddjjhs wnduddhjs wsmmuddhjs wdmyddhhjs wdmuddhhss wwdmuddhhs edmuddhjjs wdmudhdsj uwmuddhjs dmudfhjs wdmuddjks wdmuddhhja wdmudddhs wumuddhjz ip dwmudshjs wdmutddhjs wsmuddhhs wdmudyhjs wdmudhddjs wdmuddhjcc wdmudthjz re wdmudujhs wdmushdjs qumuddhjs wdmuddhkss wdnudddhjs yz wdmuusdhjs wtmudhjs ddd wdmuddhsk wdmudgjs e wdmiddjjs wdmyddhs wfmuddhhs wdmuddjja wdmuuddhjz wdmuddhss wsmddhjs wdmuddhjs wfmuddhjc wdmuuhdjs wdmuddjh tmuddhjs wdmuddhs dnuddhjs rr wdnuddhhjs wq rdmuddhjs wddmudhjs wsmudshjs wtuddhjs wdmuddajs wddmiddhjs wdmuddja wdmudfhks wdmuddhhc wddmufdhjs wdmuddhjds wduiddhjs wdmduddhjs wdmyddhsj wfmuddhjss wduuddgjs wdmuddhj wtmutdhjs wdmdydhjs wdmuuddhja wdmdudgjs dwmuddejs wdmuudhdjs wumuddhjs wfmudshjs dmuduhjs wumuudhjs wmuudhjs wdmuddeks wdmudhjds wumuddhjjs dwmuddhhs wdmiddhjjs wdyddhjs wdmuuddhhjs wtmuddhjc wdnuddhsj duuddhjs wddmudhdjs wdumddhjz wdumddjs wduyddhjs wdmuuddhsj wduudthjs wmiddhjs wdmugdhjs wdmudshjss wdmuddthjs wdmudhds t wdmusdjjs wdmufdhhjs wdudddhjs wdmuddhdjs wsuuddhjs wdmudhdjs wdmuddjsj wdmuduhj wdmuhdjs wdmddhj wfmuddjjs wdmuddhjks ui wdmudsshjs s wddmutdhjs dwmuddhj wdmudujjs wsmudddhjs wdmuddjhz qmuddhjs wdmuddhjjc wmuddhs wdmmuduhjs qo wdmdudhjd wduddhhjs wdniddhjs wduuddhjd wdmudthja wfmuddhsj wdndudhjs wdmyddejs wdmuddhja wdmddudhjs dmmuddhjs wdmmudhdjs wdmudhujs wdmuddhzj wdmmmuddhjs eumuddhjs dwmuddhjd wmduduhjs wduddhsj qdmuddhjss edmutdhjs wdmdufhjs wdumddhhjs td dwmudhjs wdmuddhjd a wdnuddhks wqdmuddhjs wumuddjhs wdmuudhjd wdmifdhjs wddmuddhhs xx wumuddhjss wdmuddejd wmduddhjss wumuddhhjs dwmuddhhjs wdmuudddhjs dwmuddgjs wdumtdhjs wdmddhsj wdmuddjjjs wdmudhjc wdudmdhjs wdmuddhgjs wdmucdhjs wdmiddjhs qduddhjs wdmiddhjc edmmuddhjs wdmdudjs wdmiddgjs wdmytdhjs wdnuduhjs wdmudddhjs wdmuddhhjd wdmuuudhjs p wdmudfjs wdmuuddjjs wddumddhjs wdmyyddhjs wduuddhja ddmuddhjs wsmdudhjs wtmuddhhs wwmduddhjs wdmyddhjs qdumddhjs wmdmuddhjs qdmuddjhs wdmmuddhjs wdmyddjs wdmufdhjjs wdmmuddhhjs wdmuddhejs wmuddhjz wduudddhjs wwdmuddhja wdmudhj wedmuddhjs edmuudhjs wfmddhjs wdmuddhhjz wdmuddhhsj wdnudshjs wdumddhjjs dmuddhks wdnuddhja wdmmuddjhs wdmuudjs wdmufdjjs wdmmuddejs wdmuddhji edmudthjs wfmuddhj wdmuddhjjd dmuddhhs wdmutdhs wsmuddhs qdmuddhjs qsmuddhjs wsmuddhjs wdmyfdhjs rt etmuddhjs wdmuddeejs wdmuudhhs wdmuddesj wdmitdhjs wdmudddhks pi wdmmuddhs muddhjs edmuduhjs wdmudchjs wddmudthjs dwmiddhjs wdmuufhjs wdmusdejs wfmuddhhjs wdmudhjjs dwmuddjs edmudhdjs wwdmuddhjs wwumuddhjs wwdmuddhjjs dwmudfhjs wdmuddhjsd wdmidddhjs wdmuddhjcs dwdmuddhjs wdmiddhsj wdmuddjjs ww wdmufhjs yy wdmudddhj wdmuddhhj wdmusdjhs wdumdfhjs wdmussdhjs wwdmudfhjs wdmuduhjss wdmudshks wdmidshjs wdmmudfhjs wwmuddhjs wmuddjhs wdmudthjjs wsmufdhjs wdmuddhjx wamuddhjs wdmmuuddhjs wtmusdhjs wdmuddjhjs www dwmuuddhjs wdmudsjs wdmdthjs wdmuddejs wwdmuddgjs wmddhjs wmuddhjc wmdudhdjs wdnusdhjs edmuddgjs wddmddhjs wdmudshj wdmuddgsj wdmdudhjc wdmmuddhj oq wdmurdhjs wdmdudhsj wwdmutdhjs wmuddhjd wsmuddjhs wfmusdhjs edmuddhhs wdmfudhjs wwdmuddhjd wdmddjhs wdmutdhjss wdmuddhjz wdmudshjs wddmdhjs wdmuudshjs wdmdudjjs wmdusdhjs wdnudthjs ds wduddhjs wdmutdhks wdmusdhhjs wdmudtjs wdmududhjs wwdmudhdjs dqmuddhjs wssmuddhjs wdmudhdjss wsmudfhjs wddmuddhhjs wduddhjss wmduddhjd dmuddejs wdmuddsh wdmuidhjs g wdmmuddhhs dwmuddhja xo wdmidthjs wdmuuddjhs wdmuuddhj wmduddhks wdmudddhsj wdmudthks wdmufdgjs wddmuddhj wdnuddgjs wdumdddhjs dmudhjs wdufdhjs zs wdmuddshj wdduuddhjs wdmiuddhjs wdmuddhjv wdmuudhjjs wumdudhjs wwdmusdhjs wmudfhjs wdmysdhjs d wdmuddjjd wdmudshjjs wdmudfhs wdmyddhjz qmduddhjs wdmudthjc wdmdfhjs edmuddjhs dmuddhjjs wsmuudhjs wfmyddhjs wdmuddehjs wumufdhjs wfuuddhjs wdmdhdjs wdmudsjjs wdmuuduhjs wmdduddhjs wumddhjs wmduddhjs wdmuddgjss wdmduudhjs wdmuddhjk wdmuhddjs wdmddhjss ezrehpsrqr wdnnuddhjs wdumddhsj wtmuddhja wdmuddhjhs wdmufdhjz wdmddhs wdmuthjs wduuddjjs wmduddjs wwdmuddhj wdmmudddhjs qdmuddhja wdmydhjs wdmutdgjs op qdmudhdjs wdmiddhjd wumuddhks wdmuuddhjjs wdmuddejjs dwmuddhs wduudshjs wdmdudhs wwdmuddhsj wdmudhks wddnuddhjs dmuddhsj wwdmdudhjs wdmmuddhjz i wdmuddes esmuddhjs wdmuuthjs wdmudhdhjs wdmudsjhs wwdumddhjs wsmuddhjc eo wdmudfhjjs wfumddhjs o wduuuddhjs wdnudfhjs fwmuddhjs wduddhs wdmuddhhd wumudhjs wdmuduhs wwdmuuddhjs aaa dmuddhjs wddudhjs wwdmudshjs wfmdudhjs wsmuddhjd wdmuddhkjs wdmuduhjs wgmuddhjs oi wmdudhjs wdnudhjs wdmudfhjss wfmuddejs wdmtddhjs wdmudsdhjs wsumddhjs wtmiddhjs wdutdhjs wdmudhsj wdmusdhjjs wsmuddejs wdmudjs eee wdmuddhhz wumiddhjs wdmiddhja wdmudds wdmuddhdj wdmuffdhjs qdmuddjjs wsmuuddhjs r wdmdudhhs wdmudshhs wdummddhjs wumuddhsj qdnuddhjs zz wdmydhdjs edmudddhjs ttt wumudddhjs qdmuduhjs wdmusddhjs dmuddhjss qfmuddhjs wumuddgjs wdmuudjjs wdmudfhjs wdmudhjs wdmtudhjs ppp dmudddhjs wdmuddhjjs wdmuddrjs wmuddhhjs wtmuddjjs wdmuddejss edmuddhjss wdmuddjc wdmufthjs wdmuddjha wsmuddhj wmduddhjjs wtumddhjs wdmuuuddhjs wdmuddhls wsmuddhks edmuddjjs edmdudhjs wdmuzdhjs wdyuddhjs wdmudfhj dmuddjs wymuddhjs wdmuddjss wdmudfhjc yu wumuddhj wmduddhhs ooo ff wdmuddjd dwmuddhks edmuddhjc wdmudshjz wtuuddhjs qwdmuddhjs wudmuddhjs wdnuddjhs dwmuddjhs wdiuddhjs wmuddhsj wdmudddhhs wfmudhjs wdmuddhjsj wmdiddhjs wdmusdhks wtmuddhjz wddmdudhjs wfmudhdjs wfmuddhjjs wdmutdhj wduuddejs wdmuddgjc wduddhj wduuddhjs wdmuuddhjd wwdmuddhks wmuduhjs wdmutdhjd wdmfdhjs wdmuduhja wdmduhdjs wdmudddhjz wdmusdhja wddmuddhjc edmuddhks wmuddhjss wumudthjs dmuuddhjs wmduddgjs wwduddhjs wdmddhhs wrmuddhjs twmuddhjs wdmsdhjs wdmudhs wsmusdhjs wumusdhjs wdnddhjs wmudhjs wdmddhjs wumuddhjc wdmudths wdmuddeja wdmutdejs wdumudhjs wmddudhjs wwdmuddejs wdmudhdja wmduddjhs wdwmuddhjs wdmudthhjs wdmiddhjs wdmuddhes wdmuddhh er wdnuddhjss wdmiudhjs wdmutshjs wdmudddhja wudmddhjs wdmusdgjs ud wdmufdjs wdmuufdhjs wdmuddhkks uz wdmuudhjs wdmddhhjs wnuddhjs wdumsdhjs wmdudthjs edmufdhjs wzmuddhjs wdmudthjd qdmuddhsj wdmiiddhjs wdmuddhhjc wdmudhdjjs wdmuddhhhjs wdmmuddhjd wduusdhjs wdmudddhjjs edmiddhjs qtmuddhjs wdnuddhjc wdmddjjs wdmdddhjs wduuddhjc du wdumddhks edmudshjs dmiddhjs q wdmudugjs qduuddhjs edmudfhjs wsmuddjs wsnuddhjs wsmuduhjs dmuddhs tt dwwmuddhjs edmyddhjs wimuddhjs wdmusdhjc ednuddhjs wdmudhdhs edmuddhjd wdmudhdj wdmudshhjs wdmuddj wdmdudhhjs wduuddhj wdmudthsj wdmudfjhs wummuddhjs wdmudjds wfmuddhjs wmtuddhjs edmudhjs wdmuddwjs dwmuddhjjs wdmudhjz mwduddhjs wdumddhj qqq qdmuddhjd wdmydthjs dmudshjs dwmutdhjs wdmudhsjs wdmuudhhjs eduuddhjs qdmudddhjs wumuduhjs wdmudddjhs wdmyddhjd wdmuddhhjss wfmuddgjs wdmuddhjas wdumddhjd wwdmuddjs wdmyudhjs wtnuddhjs wtmuddhsj qdmuuddhjs wdmudhhdjs wduuddhhs wdmddjs wwduuddhjs dt wtmuddhhjs wdmuudejs wdmiddhj wtmuddhj wdmufdhsj qdmuddjs wdnufdhjs wdmddhjz zzz dwmuduhjs f ae yyy wmduddhsj wuumddhjs wdmutdjhs wsmuddhjz wdmuddhhjjs eedmuddhjs wddmuddhsj wdmuudhjc wumuddhjd wdmuudfhjs wdmuddgs wddmuddgjs wddmusdhjs wtmudshjs wdmuddjz wdmuddhjt wdmmuudhjs wdmuddhkd xz wmuddhhs wdmusdjs wdmuddhkc wdmudddgjs dmuddhjd wsmuddgjs wdumddejs wdmuddjhhs wmudshjs wmduddjjs wsuddhjs wdmudddhjss edmuddhjs qdmufdhjs dwmuddhjs wumuddjjs wmuddhjjs wddmuddhjd edmuddjs wdmdudhj wumyddhjs wwdmuddhjss wdudshjs edmuddhjz wduduhjs wdmuuddejs wdnutdhjs wdmuudhja wfmmuddhjs wdmiddejs ee qdmiddhjs dmuddhja dwmudhdjs wtmuddgjs xc wsmiddhjs wdmuddgjd edmddhjs wduddjs dmutdhjs wdmuddhka dmuddhjz wdmudhhjs wdfmuddhjs wmuddhks wdmuddsj wdmyddjjs wdmdudhjss qdmuddhjz wdbuddhjs wwdmudhjs wdmuddks wdmmusdhjs dumddhjs wdmudshja smuddhjs wtmufdhjs wdmmuddhjss wdudfhjs wsmudhjs wdmuddjjss wdumfdhjs aa wdmuduhhs wfmuddhjz wdnuddhjs yi wdmudjjs wdmudfjjs wdmuddhhhs wdmudhjss wwdmddhjs wdmmuddjs wdmudddhjd wdnuuddhjs wdmuddh zy wdmudhjd wdmyddjhs dd wdmuudjhs wdmuddhssj xxx wdmuddhcs wdumddjhs wdmudfgjs wdmddejs qdmuddhj wdumddhhs dwuddhjs wtmuddhs wwddmuddhjs dmudthjs dwmddhjs wfmuddhks wtmuddjs wdumddhs wdmiddhhjs dmyddhjs dmuudhjs wdumddgjs wdmuvdhjs wfmudddhjs qdmdudhjs wdmuddgks wdmutdhjz wdmuddgjs k wdudthjs wmuddhja wdmutdhjc wdmudtthjs wffmuddhjs wduddhjc wtdmuddhjs wdmduthjs edmuuddhjs ea dwmudddhjs wdmuuuhjs wdmuddehs wdmyddhjc v wdmuudhks wdumddhja wdmuduhjz io wsmuddhjss wmdudddhjs dmudhdjs dwmyddhjs wddmuduhjs c wdmusdhhs qdmudhjs wdmudujs qdmuddejs wduuddjs wdmuuddgjs wdmufdhjs wddmudshjs wdmdshjs ox wduddjjs wdmudddhhjs wfmuuddhjs dmufdhjs wdmuddhjzs wdmmuddhks wdmuddjhd wdmdushjs wdmudghjs wdmusthjs wwfmuddhjs wdmudfdhjs wdmufdhs wdmuduhjjs wdsmuddhjs wdmuuddjs wddmudddhjs wdmuddjj dwuuddhjs wmuuddhjs wdmmudthjs qdmuudhjs wdmuutdhjs wmduddhj wdmuddhjaa emuddhjs wdmuddhjj wdmuddhcj wsmudhdjs edmuddhhjs wtmuddhjd wdduddhjs wdmuuhjs wumuddhhs dwmufdhjs wdumddhjs ss wdmudfhjd wdmuddhjy wtmmuddhjs wdmidhdjs wdmuddddhjs wdmudtjhs wdmuduhhjs wdmuddhjjjs wdmutdhja wdmusdhsj wdmufdhhs wdmmuddhjc wmuddhjs wdmuydhjs wwdmiddhjs wdmudshs wdmydfhjs wdmusdhjss y wdmudtgjs wdmmuddhsj qddmuddhjs wdmusfhjs wdmuddhjc wdddhjs wdmdudhjs pp wdnuddhj wdmufdhj qdmuddhks wdmuddhkz wwdmuddjhs wdmuddgjjs wdmudahjs dwmuddhjc edmuddhj wmufdhjs wdmuddghs wdmutfhjs df wddmuddjjs wdmuddjhc wuumuddhjs wdmudhdjz wdmuddhjjss wduudhdjs wdmuffhjs wdmddgjs wdmudthjs wwdmuddhjz wdmduhjs wmsuddhjs wdmufdhks wttmuddhjs wdmyddgjs wmuddejs wdmuddkjs sd wmudddhjs wdmuuddhks wwdmuduhjs wfmuddjhs wsmuddhhjs wdmusdhj wfdmuddhjs wddmuddhjz wdmuddhjja wdunddhjs wdiddhjs wdmduuhjs wdmutdhjjs x wdmuyddhjs wdmuudhs ew wdmuddkhs wdnuddjjs wdmuudhj wdnuddhs wdmuddhjsss wdmdduhjs wdmumddhjs qqdmuddhjs wdmuddjs yt wumuddejs wwdmufdhjs wdmiddjs wdmuddhhs wdmuddhjsa wmdyddhjs uu qq wduddhjz wdmnuddhjs wdmyddhjss wwdmudddhjs edmusdhjs wdmufdhjc wdmudddhjc wdmuduejs wdmudzhjs wddmyddhjs dmwuddhjs wdmuddhks wdmddhja wdnuddejs wdmudjdjs wfmuddjs wdmdudejs wdmddhks wdmudihjs wdmtdhjs wdmudshjc wdmuddjes dwmuudhjs wdmiddhjz wduddhja wmuddhj wtmudddhjs wmdudshjs wdmuddhsjj wdmusdhjz wdmuduhjd wdmydshjs mwuddhjs wdmyddhks wdmuudgjs wdmuddejz wdmusuhjs as wdmdudhjjs wdmuddhsj wdmdudhks wdmuushjs dwmudthjs wwdnuddhjs wdmufdjhs wfmuudhjs wwdmyddhjs wmdutdhjs wduuddhjss wddmuddhjss wddmuddjhs wdmudvhjs wdmuddfhjs edmuddhs iy wdmudsgjs qdmuddgjs dwnuddhjs wduutdhjs wdmufdejs duddhjs wdmuddhje wduuddhsj wdmuddhjdd dwumddhjs wdmyddhjjs wduuddhjz wdmyuddhjs wdmudfhhjs wmduddhs wdmuadhjs wdmdidhjs we wdmufdhjd wtmudhdjs wdmuddshjs wdtmuddhjs wdmuddhju wmduddhhjs wdmuduhsj dmuddhj wdmiddhks wdmutdhjs wddmuudhjs wdmudshjd wdmudhhs wfmuddhja wmuddjs wtmdudhjs wdmuddhk wdmusdhjd wddmuuddhjs wmdufdhjs wdmyduhjs wmduuddhjs qdmyddhjs tr qdmudshjs wmudhdjs wdmuddgjz wdmudfhja dmuddgjs wcmuddhjs wdmudfhsj wdmuddhjsc wtmudfhjs wudddhjs wmdudfhjs wtmuduhjs wdmuthdjs wsmuddhjjs wdmuudhjss wtmudthjs wdmuddhjsz wdmuddhhks wdmmufdhjs wdmuddhjf dwmuddhjss wdmuudthjs wdmufdhjss wdudhdjs wuudnddhjs swunddhjs wdunduhhjs wdunnddhjss wdunttdhjs wdunddjgs wdunddhjzz wduuddhjjs wwdunduhjs wduunduhjs wtunddhjss wdunffdhjs wduntdjhs wdnuddhjjs wdunudjjs wdunduhsj wfundhdjs wddunddhjz wdybddhjs wdundhdjc wduuddhjss wudnddhjss wduntthjs wdnfdhjs wdinddhjs as wdundhdj wdnddhjjs wduntdhhjs wdunnsdhjs wuunddejs wdynddhs wtunddejs wdyndfhjs wdunnnddhjs wudndshjs edunddjjs wdumddhjjs wdunddhhjd wuunddhjss wdunuhjs wdumddejs esunddhjs wdiinddhjs wdunddhcs wwdundfhjs wfubddhjs wudnddhhjs wduntddhjs wddunddhjc edubddhjs wfunddhjd wdyynddhjs wdundshja qwdunddhjs wduyddhjs wunddgjs wddundshjs wdunddhhja wdunnddgjs wunddhks wwduunddhjs wduunnddhjs wdunadhjs wdunuthjs e wdubddhja wduunddhhs wudbddhjs wudnddhjd wsunddhja qdundfhjs wuunduhjs wdunfdhjd wdnuddhj wduundfhjs wuunddhja wdnddhj wddunddhs wdynduhjs qduddhjs dwundshjs wdunddhhjss wdundthjjs wdundthjc wnuddhjs wdumdshjs wdunudhks eduntdhjs wduuddhjs wdundshjz wfumddhjs wdunddfhjs wtunddjjs qdynddhjs wdummddhjs wdufdhjs wynddhjs wdunddwjs wfunddhhs wduunudhjs wdundfhja wtunddhjs wdududhjs wduunfdhjs wsunddhks wdudndjjs dinddhjs wunddhjjs wduunddjs wdunddks wsubddhjs wttunddhjs wduntdhj wdunssdhjs dwunnddhjs wdunshjs wdundhjs dundddhjs wtuddhjs wddunddhhjs dwunddhj wwuunddhjs wduddnhjs wudnsdhjs wdunddhjsd wdunduuhjs funddhjs efunddhjs wdunnddhj wdunddhjsz qdunddhs wdunushjs wdunfddhjs dwundfhjs wdunddhju wuuddhjs aa wduduhjs wdnunddhjs wdundgdjs wdunddjh dwwunddhjs wdundsgjs wduddjhs wsunduhjs wdundyhjs wwdunddhjjs wdunfdhjz wduuddgjs wfunddjs wdunddhjja wddnuddhjs wedunddhjs c wdundddhjjs wsuunddhjs wdundths wuddnddhjs wuynddhjs wddunddgjs wfynddhjs wdundshsj wdunddhjaa qdundhjs wsuuddhjs wdundjs wssunddhjs wdunzdhjs wdunddhhj dundfhjs ee wdunddhgs wdudnthjs wduunddhhjs wtunduhjs wdunddhjz wdumfdhjs wsuntdhjs wdunnddhks dunddhhs dwunddhjz wdundhujs wdunuudhjs wdunddhjsss wdundtejs wdnddhjss wdundfhjs qdubddhjs wdunvdhjs wundddhjs wdunfdhjs wduunsdhjs wduddhks wdunddhje wdundddjhs wdubddhj wwduntdhjs dwunddejs edunddgjs wdundfhsj wdynfdhjs wdnuddjhs wdubduhjs wdynddhjs wdinddgjs wtnddhjs wdnuddhjc wsundthjs wdundujhs wdunfdjhs dwunddhks wuunddhjc wdundedjs odunddhjs wddunddhj wdunddhjjs wduunddhks wdunddgs dwunddgjs wdunsdhjs wdubbddhjs wdiddhjs wdunddjhjs wdunsdhjss wwdnddhjs wdynddhks wdinddhjss wdundtjhs wsunddhjz wudnduhjs uunddhjs wdnddhjs wddunddjs wdyntdhjs wdunndhdjs wfunddhja wuddndhjs wdumdthjs wdundrhjs wdunddeks wdunddgjss wdunddhc wdudndhja wdudthjs wddumddhjs wuunddhjs qdnddhjs wsunsdhjs wduuuddhjs wdundddhja wuunddhhs wuundthjs wdunnddhjz wuunddhhjs wduncdhjs wdndhdjs wdundudhjs wdunddhjjjs wdundzhjs wfunddejs wdundhhjs wwdunddhjss wfunddjhs qdunddejs wdundthhjs wudddhjs qdunddhhjs wdinddhhjs wfundhjs wduntdhja wfunddgjs wtunddhjd wdunhdjs wdunudhsj dwinddhjs wwdynddhjs wdudddhjs wdunddhhjjs wdunfhjs wdubdhjs wduddjs wudnddhks dunddjs dunddhjc wdundhdsj wdundahjs wdunsuhjs wfunddhjz wduuddhja qdundddhjs wtunddhs wdinnddhjs wtunddhhjs wdunddhkd wddunddhhs dwunddhhs wdinddhjz wdunfdjjs wduudshjs wduntdhjs edunddhjc dynddhjs wdundds wsunddjjs wuuuddhjs wdunddhja wduntdejs ewdunddhjs wdundddhjz wuunsdhjs wdunudjs wddudndhjs wdundfgjs edynddhjs wdundddhhs wdunduhjs wdunnddhhs wwdubddhjs wdunduhjjs wdundgjs wuunddhsj wdundthjs wduntdhjc wdunddjhhs wdidndhjs wdunudejs wdumddhjd wdundhsjs wdnuddejs wdundthjd wduddhj euunddhjs wdunddhsjj wdunsdjjs wundfhjs wdubddhhjs wdunuhdjs wdinddjhs wdunudhj wdunsdhjc eunddhjs wdnuddhs wdinddjjs wdimddhjs wdunddjja wwwdunddhjs wdunddhka wduuddhjc wduddhjz wduunddhj wwdinddhjs wdundffhjs wdunddjd dumddhjs wudnddhja wdinddhhs wdnddhjd qdinddhjs wdunfdhj wdudndhhjs wdunudhjd wrunddhjs wdunsdhhs wdunudhjs wundhjs wdunfdgjs wdntdhjs dwunddhjd wdundhjc dunddhjjs wdunshdjs wdundjdjs wdundhdja wdyndthjs wdyndshjs wsunddjhs wdduunddhjs dwunddhsj wdunsdhjd wdunddhjd wdundddejs wudnudhjs wdynddejs wunfdhjs uwdnddhjs wdunddjjz qdunduhjs wdundehjs wwdunsdhjs wdubddhjss wdunddhkss wduuddjhs wddnddhjs wsinddhjs qdunddjhs wdunddgj wdinsdhjs wdundujs wdundndhjs wdnuudhjs wduudhdjs wdunddjsj wdunffhjs wunudhjs wdumudhjs qfunddhjs wdunddhjjc wsunddhhjs wdundshs wfuntdhjs wdnuddhjs wdunntdhjs wdfunddhjs wcunddhjs wdudndjs wdunsdhs wdnddhhjs wdumddhja wdubddhhs wdundddhjss wdnsdhjs wwudnddhjs dwunduhjs wdunddhhhs edunddhjjs wddndhjs wdudfhjs wunddhja dwunddhhjs wdunudhhjs wddundhjs wdynddjjs wdumddhj wduuddhj wdunnddejs dunddhsj wdunddhha wsnuddhjs wuundhjs wdmuddhjs wduunddhjjs wdunddes wddundfhjs s wwdunddhhs wdniddhjs wddunddhsj wdunsdjs wdnnddhjs wffunddhjs wiunddhjs dunddhjz eddunddhjs wwsunddhjs wduntdhks wdduntdhjs wdubddgjs wdibddhjs duntdhjs wundshjs wdubdshjs wdundchjs z wdundthj wdundfejs wdundddgjs wtynddhjs wddudhjs wdunddhhc wdunddhjhs wdunnddjhs wdundfhjc dunddgjs wfunsdhjs wdunddesj tunddhjs wwdunddhja wudnddejs dunduhjs wdunddjhc wdubdthjs wdundtthjs wduntfhjs wdnddhjz wgunddhjs dwundthjs wdunddhjy wduntuhjs wdunddjc dunddejs wdundhhdjs wduuddejs wuinddhjs wdynudhjs wduunddjhs wdunfhdjs wdbddhjs wdunddgks wduuddhjd wdundhdjd wfuddhjs edunddejs wdundshjc wdinddhj dwunddhjss wdunfdjs wdynddjhs qdunddhj wdudndhhs wdunddjhss wsunudhjs wdunddhj wdundfjhs wduddhs dunddjjs wdubddjhs wdinddhjjs wduaddhjs wtunnddhjs dunudhjs sunddhjs wdunddhhz wdunfthjs wduddhjs wunddhjz wdundhhs wfunddhjs wfdunddhjs wdndshjs wwdunudhjs wsunddhjs wsunddhs wddunduhjs wdunddhhhjs wtunddjhs wdunddjes wduiddhjs edunnddhjs wdunddhjjz wwdunddjs wunuddhjs wtundddhjs wduddhhs wdunddhsj qdunddhjz edundfhjs wdufndhjs wdundddhjs wdnufdhjs wdundhjz wuunddhj wfnuddhjs wdudnfhjs wubddhjs edunddhja wdyddhjs wdndudhjs wtdunddhjs wddunudhjs wdunddhss wdumddhjc wdnuddhhs wdunddgjs wdunudhjss wduntshjs wdunduhjss wunsdhjs dwundhjs wdundhdhs wdtnddhjs wqdunddhjs wdunddkhs ddunddhjs wdumddhs qdunddhjs wwdundddhjs edundshjs wdubnddhjs wsunddhsj wddunnddhjs wdunsddhjs wdunddehjs wdunddhhjs wwduddhjs wwdunddgjs wddundhdjs dwunfdhjs wdunddh wdunudhjjs dunddhj wdunduhjd wduumddhjs wdynddhjz wtundshjs wdunddhkjs wdunsdhhjs qdnuddhjs wsnddhjs wdunddej twunddhjs wdbuddhjs wudnddhjs wdtunddhjs rdunddhjs wdunddhcj wfunduhjs wdundfdhjs wdunudhjc wudnnddhjs wumddhjs wwunddhjs wdunddhsjs wtuuddhjs wuuntdhjs wdnudhdjs wuunudhjs wdunsshjs wdddhjs edundhdjs wsunddjs wduddhhjs unddhjs wdduddhjs wdundhdjz edunsdhjs wduunddhjc wdudndhs wdunsdhsj wdunddgjc wduntdhjjs wtuntdhjs wsumddhjs wdunddjhz wdudnndhjs wdunddhdj wdunddj wdundjdhs wdunddgjd fwunddhjs wsunddhjss wdudndhj edunddhsj wdubddhjjs wdunsdejs dwunddjhs wduundthjs wdunddhjsc wdubudhjs wdundfhjss uwunddhjs wduuddhjz wsuddhjs wdunndhjs ddwunddhjs wdumddjs etunddhjs wdnuddhja wdunddhjas dwuunddhjs qdumddhjs wduutdhjs wddunddhjs ss wdundddjs wwdnuddhjs wnduddhjs wdunddsh wduntdhjz wdunddehs wdunsthjs wutnddhjs wddunddhja wdynsdhjs wduddhja edunfdhjs wunddhjs edundddhjs wdundhjd wdundhdjjs wdunddhkz wdddunddhjs wdunddthjs wdunduhhs wdnuddhjz wdnddgjs wdunddhjs wdnudfhjs wdundvhjs edunddhhs eedunddhjs wdundhja wduunddjjs wdynddhjd wdunddhjv wtundhdjs wdindhjs wdunddhes wdunddhjcc wdunddhjsa wfudndhjs wdudmdhjs wuundshjs wudntdhjs wdundfhhs wdnuddjs wwdunfdhjs wdynddhjjs qqdunddhjs duunddhjs wdunddhjjss wdundhddjs dwnddhjs wwdunddhjz wdinddjs wdunddhjt wdnddjjs wdndthjs wduddhjd wdunsdgjs wdunnfdhjs qdundshjs wdunddhssj qdunddhjc ae wdunddhjcs wudndhjs qejwygnb edunddhjz wdundfhjz wfnddhjs dwdunddhjs wdunddhgjs wunddhjd uwnddhjs qdunddhjd wdunddhsk wunddhjc wduudddhjs wwdunddhs wuunddhjz wuunddhs wdundfhks wdumdhdjs wunddjjs sa wdunddhsh wtunsdhjs wunddhhs wdunddsj wdunddshjs wdinddhja wdunduhks wdubddjs wsunddgjs wdunbddhjs wdunmddhjs wdndddhjs dwunddhs wdunddhaj udnddhjs wfuuddhjs qduuddhjs wdunddhejs wduufdhjs wdnddjs wdubddhks wsundhdjs wduuunddhjs eudnddhjs eduuddhjs wdunddjjc wddundthjs wdudndgjs qdunddhjjs wdynddhja wduudfhjs wdundujjs wdundhds edunddhj wdynddgjs edunddhs wdunddhkc wdumdfhjs wdundddhjd wdudbdhjs wtunddhjc wduntdhhs wdnuddhjss wdynddhjc wdundfhhjs wdutndhjs qddunddhjs wwdunddejs wfuunddhjs wdundsejs wdundhs wdunddojs wdintdhjs wdunddjz wduunddhja wuundhdjs wtudndhjs wdnusdhjs wdynddhjss wdubddejs wuunddhjjs wdundfhj wduundhjs wdundghjs wdundhdjs wduntdhjd wdnudhjs wwdunddhhjs dwunddhjs wduunddhs r wdundhjss wdumtdhjs wdundfhjjs wdundhdjss dunddhhjs wdunuddhjs wdunddgsj qdunsdhjs wduddhjjs wvunddhjs wduuddjs wdundduhjs wudunddhjs wdunduhjc wdunrdhjs qtunddhjs wdudnuhjs wududdhjs wndddhjs wduundshjs wduunddgjs wdundddhhjs wdunthjs wunddhhjs wdunddhhks wudnddhj wdinudhjs wddunsdhjs wwdundhdjs w wdundddhsj wuuunddhjs wundhdjs wuunddhjd wdynddhsj wdundshks wdndhjs edunddjs wdundfjs wdunddjhd wdunddhjds wdundddhjc wdunnddjjs wdunfdhhs wdunfdhjss wdunddgja dnddhjs wddynddhjs wduntdjs wdundejs wdnudthjs ednddhjs wuunddjjs duwnddhjs wdunddjjss o wdynddhj wdumdddhjs wdunddeejs wduuduhjs wdunddhhjc wtundhjs wdunddhs wdynnddhjs qdunddhja wdinddhjd dwumddhjs wdunddejss wdunddjjjs wdindfhjs wdunddejc wddunddhjss wdundhj wdunddshj wdnuddhsj wdnuddjjs wdiunddhjs wwdumddhjs wdunndfhjs wduddndhjs wdunddjjhs wdunddjjs dundhdjs wsundddhjs wdnddjhs wdnddhs wdunddajs wdunddhjk wdunddghjs wdindshjs wdundsjhs wtunddhja wtundfhjs wdundtjs wdunddhjsj wdundtdhjs wduundhdjs wduuudhjs wduuddhks wdunthdjs wdubddhjd wyunddhjs wdunddhjj wsunddhjd wddunddhjjs wwdunddjjs wdumduhjs wdunddkjs wdunfdejs wufnddhjs wddunddhks wfunddhks wdsunddhjs dwubddhjs wdunudjhs wdunfshjs wdndfhjs duddhjs wdunsdhjz wdindthjs wduuddhhjs wdymddhjs dunddhs wdundjhs edunddhjs wduddejs wudnddhhs dudndhjs wdusdhjs dwunddjjs wdundshj wdumddhks wdunddgjjs wduunddhjd dwundhdjs dwunsdhjs edunddhjd wfunnddhjs wdunfdhsj wdnddejs wwdunddjhs wsunddhjc wdubddjjs wunddhs wdunddhjzs wdunddjs wdundsjjs wdubddhs wduuddhs wudnddhsj wdundsjs wdumdhjs dwuuddhjs wdunddhzj wwduuddhjs wunduhjs dwunddhja wdumddgjs qdunddjs wduudthjs wdundddhj wunnddhjs wduuddhsj wdyndhjs wdunddhkks wduddhjc wtunddhks wdyndhdjs wdubddhjc wdduuddhjs wudndthjs wudnddhs wdunnduhjs wdnuddgjs wdumddhsj wdyndddhjs wdunidhjs wdynddhhjs wdunnddhsj wdunddhhs wdiuddhjs wdinfdhjs dunddhjd wduudhjs wdudndejs wdundsdhjs qdunddhks wunddhjss wunddjhs wuunddgjs wdunduejs wdmddhjs wdumnddhjs a wdunnddhjjs wunddhj wdudshjs wdinddhjc qudnddhjs wdunnddhjd edunddhhjs edumddhjs wdunduhjz wddinddhjs wdudndhjd wduntdjjs wudndhdjs wdunddhjss wdundddhks deunddhjs wudndddhjs qdudndhjs dunddjhs wwdunddhks wsundhjs wdundthja edinddhjs dwudndhjs wnddhjs waunddhjs dunddhjss wsunddejs wdunddhjc dwunddjs dunnddhjs ednuddhjs wdunddhhjz wfunddhsj dwuntdhjs wdunduhja wdunnudhjs wdnuddhjd wdunsdhks wdunndshjs qdunfdhjs wdudhjs wsunfdhjs qdunddhjss wduunddejs wddundddhjs wdunddjss wfunddhj wdnddhja wdubddhjs wdudnddhjs dunsdhjs wduddjjs wdungdhjs wdunfdhja wdundugjs wdundthjss wdunddjsh wdumddhjz wddunddejs wdunnddhs qdundthjs wddunddjhs wdumddhjs wdubddhjz qdunudhjs wdubfdhjs wdundhks wdunnddhjc wudnddhjc wdnddhjc wtunddhsj wdundhdhjs wdunddhh qdunddhhs aaa dwnuddhjs dundthjs edudndhjs wddunddhjd dubddhjs wdundshhjs wdunddejs wdunudhjz wdundfhjd wuumddhjs wduynddhjs wtnuddhjs wwfunddhjs wddunfdhjs wfunddjjs wdundfjjs wdundddjjs wdubdhdjs dundhjs wduunddhjs wdunduhj wdunhddjs wduunddhsj wtunddgjs wduntdhjss wdunudhs wudnddjs qunddhjs wfunudhjs wwdundshjs wdunudgjs wduudndhjs wduntdhsj wdunedhjs wdunddja wdunfdhks wdindddhjs wwdunddhsj wddubddhjs wudnddgjs dunddhks wdunfdhjc wdunfdhhjs wtundthjs eduunddhjs wudnddjjs wduundddhjs wfinddhjs wfunddhhjs wdunddfjs wdundshjss wdunduhs wzunddhjs wdudndjhs wudmddhjs wdudndhjs wduunddhjss wdunddggjs wdunnddhhjs wudnddhjjs wdunfdhjjs wdinduhjs wdusndhjs dunddhjs wdunddhjjd quunddhjs wdundjjs wdubsdhjs wdunsdhj wdunddha wdunddhls wdumddhhjs wdnuuddhjs wdnnuddhjs wtunudhjs wsundshjs wdunddhhss wdutdhjs wdundhsj wdumsdhjs wwddunddhjs wduntdhs wdunhjs wuunnddhjs wduddhjss wudnddjhs wtunddjs wsynddhjs wduddhsj edunddhjss wdnddhhs wuunddhks wdumddjjs wdnuddhks dwunddhjc wdundhfjs wfunddhs wydnddhjs wfundfhjs wwdunddhjs wdunsfhjs wdnudddhjs wdundthhs wdunndddhjs winddhjs dwynddhjs wdundhdks wdundhjjs wtunddhjjs wtuunddhjs wdunnddhjs wfunddhjc qdunnddhjs wdudnhjs wdunfdhs wdunsdhjjs wdunddjhs wfunfdhjs wdunddjks edundthjs wdubtdhjs wdunddhk wsunnddhjs qdunddjjs wdunddhdjs wfundddhjs wunddhsj wdynddjs wdunddhd wdyuddhjs wudndfhjs wdundshjjs wdubddhsj wtunddhhs wdinddhks wdundhjds dqunddhjs wduuntdhjs wdydndhjs wdunddejz dunfdhjs wdunddeja wdnddhks wdundtgjs wdundshjs wdunudhja wdunufhjs wtumddhjs wdubdddhjs wtunfdhjs wfundthjs wdunnddhja wdudndhjjs wundthjs wuntdhjs wdnuduhjs wdundthks wtunddhj wdubdfhjs qsunddhjs wunddejs wuubddhjs qdunddhsj wdunddhhd wduuddjjs wwdundthjs edundhjs wdindhdjs wdundthjz wduubddhjs wdudndhks edunddhks wduuddhhs wdudnshjs widnddhjs wdunddhjdd wudnfdhjs wdunddghs wduntdgjs wdunydhjs wdudnhdjs wdunddhhsj qduunddhjs wdudndhsj edunddjhs wdnudshjs edunudhjs wduusdhjs wfunddhjjs wsunddhjjs wdundsshjs wdunddhjf wwdunddhj dwuddhjs wdumddhjss wdunddejjs wuudndhjs dwunddhjjs weunddhjs wdunddhjks wdonddhjs wdundfhs wdinddhs wduinddhjs wtunddhjz qdunddgjs wdnddhsj wduddgjs wuundddhjs wwdudndhjs wsunddhhs wdunddgjz wfunddhjss wdinddejs wuunfdhjs wdundthsj wwdundhjs wdunndthjs wdundtjjs wdunuuhjs wsunddhj wdnduhjs wdudndhjc wtubddhjs wsdunddhjs wdnuddhhjs wdundhtjs wdunddhz wwdunddhjc wuunddjhs wdunddrjs wdunddhks wusnddhjs wdunudhhs wunddjs d wdundshjd wwtunddhjs wdunsdhja wduunddhjz wwdunnddhjs wdunddjjd wdumddhhs dundshjs dnuddhjs wsudndhjs wdunsdjhs wuddhjs wdnutdhjs ea dwundddhjs wudnddhjz qduntdhjs wuundfhjs wdunfuhjs duuddhjs wddunddjjs wdundihjs wdynddhhs wdwunddhjs edunduhjs wdunddjj dwunudhjs dunddhja wduvddhjs wdundshhs qdundhdjs wdundddhs wdunddejd wdundjds wdnyddhjs wfundshjs wuunddjs wdunddhji wdunddddhjs wdudndhjss wsundfhjs wdudndhjz wwdunddhjd wdyunddhjs wdunnddjs eduddhjs wdunddjha wtinddhjs wdumddjhs wdunddhjx wdinddhsj wfundshjs wdunddhjks wwudnddjha wwdundjhc wdufndhjs wwdunddjjha wwduunddjjhs wduntdhhs wwdunfdjhhs eedunddjhs uwdnddhjs wwsunddhjs wsunnddhjs wqdundfjhs wwuunddjjs wduuddhks wsunddhsj wwdundtjha wqdunddjha wdwuddjhs wdunddks wduddhks wdunddjh wwduunddjsh wdunedhjs wwdunddjhu wdunddhhja wwudbddjhs wwtunddjhhs wtunnddhjs wdundthjz wwundfjhs wdunshdjs wqdunddjes qunddhjs dundhdjs qedunddjhs wwdunddhhz edunddejs wuddhjs wwdinddhjs eedunddhjs wwdunddkes wduncdhjs wwdundshjs wwdunusjhs wwdumddjgs wwsundujhs wduntdhjc wduundhdjs wtunddjjs wwdunddkha wduunddhsj wdundsshjs dunsdhjs wwsunddjjs wwdumddjhhs wwudnddjhz ewdinddjhs wdundddhjz wwdiunddjhs dnddhjs wsudndhjs wdunduhja wdumddhjjs wdumddhhs wduddhsj wwdunddjg dwdunddhjs wwuunddjhd wwdumdfjhs wwfundfjhs wdunddjsj wdunsdjjs wdudnhdjs wwdunddhhjs wdudnndhjs wwdundjhhs wwdnuddjes wwwdunddhhs wwdunddjrs wduwnddjhs duntdhjs wduunddejs duunddhjs wwdumddjsh wwndddjhs wdumdshjs wwdunddjos wtunddhjz wwduunddjgs wdnudhdjs wdnddhj wwdunnddjha esunddhjs wdunddhes wwssunddjhs wdubddhs wuundhdjs wdnuddhj edunfdhjs wdunuthjs wdnuddjs wwtunddjjs wwduddjgs wdnfdhjs dwunddhks efunddhjs wdundtjs wuunsdhjs weddunddjhs wwwdunddjha wundhjs dwumddhjs wwdunddhks wwdundndjhs wwudnddjes wduntdhjd wwdonddjhs wdunudhhs wtunddgjs wwunddhjs wduunddhja wwdunuujhs wwsunddjha wdunnddhks wfuddhjs wwdundzjhs wwdunddjed wwdudndjjhs wwdunddjjjhs wwdunduhjs wdundejs wdundhdks wdunddggjs wdunnsdhjs wwdundfjhz wwdnuddjhhs wuudnddhjs wwduundfjhs wwdunddujhs qwunddjhs wtunddhhjs wwdnddjes wwduudjhs wwuuunddjhs wwdundjdes wwddundujhs wtunddhj wwduntdjsh wwdumddjha wudbddhjs wudnddhks wfunddhjjs wwdnddhjs wwdyndfjhs wdundshj wdunddhh wwwdunddjjs wwwdunddjhs wwdynddkhs wwdunddjch wwduyddjhs wwdudujhs wwduundddjhs wdunsdhs wwdunidjhs wdundhds wwdunddjjd wwdundjfhs wqduuddjhs wwdinddjhs qwdunnddjhs edunduhjs wwduntdjhs wwdumdjdhs wdunsdhsj wdunddhha wwdumdujhs wdunddhks wdyndthjs wwduddnjhs wdunddjja qdunddhja wdundthhs wwduddhhs dunfdhjs ewdunddkhs wwdundjdhhs dwunsdhjs wsundfhjs wwdundyjhs wwunddjhhs wwdunddjks wqdunddjhhs wwdundddjs wdinddhhjs wwdudddjhs wdynddhjc wwsunddjes wdinddhjjs wdundddjhs wdunddeks wfudndhjs wdudndhjz wwdunddghs wddumddhjs wwdumdddjhs wwdundsjgs wwdundssjhs wdudndhjs wudndthjs wqdnuddjhs wwdunddjhsd wwdnuddjhs wwdunddjd wwdnudsjhs wwdnddjhs qddunddhjs wdundhjc wwdumddjhs wwfuntdjhs wsunddhhjs wdunudhks wwunddjsh wdunddghs wwdunddhes wddubddhjs wwdudndjes ewdundtjhs wwaunddjhs wdinddhjs wdundddhhjs wwdinddjhz wdundddhjd wwdunnddjgs wwtunudjhs wdunddhhjz wdududhjs wedunsdjhs wwdnddjhz wwdundtjhd wwduddjs wdynddjhs wdunddhdj wdunfdhj wwduuddhjs wdunsddhjs wedunddhhs wduntdhj wdnuddjhs wwdundddhjs wdinddjjs wwdunudkhs wdumsdhjs wwdunsdhhs wdynddhks qwduuddjhs wwdunudhs wwdudndhhs wwdunddjz wwedunddjhs wuddnddhjs wtundshjs wwdunnddjhs wsunddjs dwunduhjs wwdundddhs wdunfthjs wdunddhjss wwfunddhjs tunddhjs wwdinddjhc wwdindsjhs wwddnuddjhs wdunddjhs wdnddhs wwdunddjhhz wwdudndjhc wwdunddjhzs wsundhjs wddunddhjc wdundtthjs qwdunddjhc wwdunddjgss dwunddhhjs wdynddhjjs wdunfdhhjs wduddejs wfunddhjss edunddjhs wwdunddjssh wwtumddjhs wwdintdjhs qwdundjdhs wwdimddjhs wwdubddjhs wdmddhjs wdunddes wwudndsjhs ekrz wdnuddhhjs wduddhjs wdubdthjs wsunddgjs qwdunddhs wwdunddjhcc wwduudujhs wwsuuddjhs wwdynddjjhs wwduddhjs ewdnuddjhs wwdundfjjs wwdnuddjh qfunddhjs wdnddjjs wdunddhjx wunddejs wwdnudddjhs wwdundjhz wwdudntjhs wdundds wwdunddjjhhs wwdundfjh wwwdunddjgs uunddhjs wvunddhjs wdundfgjs wwduntdjjs wtumddhjs wduunddhjjs wwdunsdjhhs wwunddjha wdundthjd wwfunddjhss wwdundjhd wwqdunddjhs dwunddhj wdunddesj wdunsdhjjs wfunddhjc funddhjs wwdunddjj wwduunddjha wwdunddjhhd wwdubddjsh wwdubddjs wwtunnddjhs wwdundsdjhs wdumtdhjs wwduynddjhs wwduudsjhs wdumduhjs wwdunffjhs wwdfunddjhs wdumddhks wdynduhjs wwudnsdjhs wdudndhsj wwdnddjgs wwdnuddjhc wwdunddjja wwdnnddjhs wduduhjs wwdundujha wwduddjhs wwdunddj wdunddhjhs wwdunfsjhs wwdunnddjjhs wwddundjhs wdwumddjhs wdduuddhjs wwdnudujhs d wdundfhks wdunsuhjs wwduntjhs dwunddhja wwddunddjjhs wuunddhjjs wdnddhjc edunddjjs wwduundjdhs wwdunsdjh wwsinddjhs wwdundddkhs qdunddhhs wdundshjz wdynddhhjs wduntdhsj wwzunddjhs wudnddhjc wdubdddhjs dqunddhjs wwdunfjhs wwdubsdjhs wdtnddhjs wdnddhsj wyunddhjs wwduuddjhc wwdinddjes wdunudhsj wwuddjhs wtwunddjhs wwdundjdgs wdunduuhjs ewdunddhhs wdunnddhsj qdundfhjs wdunddhs qdumddhjs wwdnsdjhs wwuudnddjhs wuundshjs wwduuddjhs wwddunddhjs wwdunddjhhc wwdinddjh wwduunfdjhs wwdumsdjhs wdunfdhjjs wdundduhjs wdumddjs wwdnusdjhs wuuddhjs wwdunddjhdd wduddhjss wwdinddjs wufnddhjs wddunddejs wdunudhjz odunddhjs wqdunddjh wdundhdja wdudnfhjs wdudnhjs wdunfdjhs wydnddhjs wduudfhjs wwduuddjhz wuunddjs wwuundtjhs wedunddhs wddunddhjjs wddunddhja wwdunfjdhs wdundhdhs ewdunddjjs wwdunudhjs wwduunddkhs wwwudnddjhs wwdundddjha wwdundcjhs wedunddkhs wwdmuddjhs wwrunddjhs wwsunddjhs qwdunddjh wwdunudhhs wdudndejs wwdunddjhds wwdunduhs wdintdhjs wwdndjdhs wdundedjs wdunddjgs qwuunddjhs wwddunddjgs ewdubddjhs wwudndfjhs wdunddjha edunddhsj wwdnudfjhs wwdnuddhs wdubbddhjs wwfunddjjs wwdunddjhy wddunddjhs wdynddgjs wqdunddjsh wwsunsdjhs wwsunddjh wwwtunddjhs wwudnddjsh wwddunddjs ewdunddjjhs wduumddhjs dwynddhjs wdutdhjs wednuddjhs wfuunddhjs wunddhj wwudndtjhs wwdundsjhc wwdundddjhs wwdunuddjhs wduntdjs wdyndhdjs wuunddgjs wwdubddhhs dunduhjs edunddhjz wwdunssdjhs wduuddhjd wwsunddhs wnuddhjs wwdunduujhs wdnuddhjz wwwdunddjjhs dunddhjs dwwunddhjs wdnudfhjs wwuunddhs wdunddhhs wdudnddhjs wwdunddjhhhs wwdubddjhss wdunddh wqdunddkhs wdundfhjc ewudnddjhs wuunddhj eddunddhjs wwdundujgs wduntdjhs wdiunddhjs swunddhjs qqwdunddjhs wwdundsjhz wwsundfjhs wwunsdjhs wddndhjs wdufdhjs wsunddhjc wdunndhdjs wwddunddhhs wwdubddjjs twunddhjs wdunsfhjs wwdundudjhs weduddjhs wwfubddjhs wwtubddjhs wwwdnuddjhs wdunsdhhjs wwduuddkhs wwdndtjhs wwdunsujhs wwdunddjggs wdundugjs qwdunddjjs wdunfdhjss wedinddjhs wdunnudhjs wwdynddjjs wdunddhhks edunsdhjs wwfudndjhs wdundahjs wwdundjjhs ewduddjhs eduntdhjs wdunddhkjs wwduutdjhs wwdnyddjhs wdunddgja wdduddhjs wwdundhs wwsunddjhd qwdnuddjhs wwduuddjha wwduntddjhs wdundshhjs wdundfhjd wdwunddjhz wwdundddjhss wwdunddks wwdunddjhsz wwdunddjhz o wwtunddjjhs wwdundjds wwddunddjh wwdindujhs wdnuddhsj wwdtunddjhs edunddhja wdwunddjsh dwuuddhjs wdunddhjf wwinddjhs wwdnudtjhs wdnuuddhjs wqdudndjhs wwdunddjhjs wwdunadjhs wwdundfjgs wwdubdfjhs wwdundjths wwduntdjgs wudnddhja wdubdfhjs wdunddhz wundddhjs wduntddhjs wunddhjjs wqdunfdjhs wdynnddhjs qdunddhhjs wwdbuddjhs wwdndujhs wdundshsj wwdunufjhs wwudntdjhs wwunddjgs wquunddjhs wwtunddjs wwdunddkh wwuuddjhs wwduntdjhhs ewtunddjhs wdunfdhks wwdyndujhs wwtuddjhs wdyndfhjs wwfuddjhs wwdunddjgs wfunduhjs wwdindtjhs wdwunddjhhs wdwundjhs wwdundfhs wwdubddjh wwdunnsdjhs wdunddhcs wwdunfdjhd wwduudtjhs wwudnddjhss wwdynfdjhs wdunddjj qqdunddjhs wdunddhsjj wwdunffdjhs wwddunddhs wwdunddjkhs wdudndhjss wwsunddjhhs wwdnudjdhs wwuynddjhs wwwdunfdjhs wwdunddhsh wdunrdhjs wwdynddjha wunudhjs wdunddhhsj wdunddejc wwdunfdkhs wdunfdjs ddunddhjs wwsunddhhs wwdunddjhhs wwdnuddhjs wdnuddhhs wwfundjdhs edundhjs wdunddhsh wdubddhhjs wwdinfdjhs wwdybddjhs qdinddhjs wdinddhjc wdundshhs ewdundddjhs wdunydhjs wdubddhjd wwunddjhc ewdunddjhss ewwdunddjhs wduuunddhjs wwdudndjgs wwdunfdjes wwtunddjha wsunduhjs wwdubdsjhs wwwdundjdhs qdynddhjs qwdunfdjhs qdunduhjs dwunddhsj wwuunddhhs wwtunddhjs wdunfdjjs wwuunddjes wwdnddkhs qwwdunddjhs dnuddhjs wdunddhjdd qwtunddjhs wqdunddjgs wdunddhhj wfuntdhjs wwdudjdhs wdunddhjj wdunudhs wwusnddjhs wsunddjhs wdunddhk wwdundddjjhs wdqunddjhs wdundhhdjs wwddundtjhs wwdudbdjhs wwdnddjsh wdnddhjss wdundtdhjs wwdibddjhs wwduinddjhs wdunddjjss wdundghjs wwdynnddjhs wwundjhs wdundshjc wduuddejs wwdundgjhs wedunddhjs wwuntdjhs wwdundujhhs wwdundddjes wdubddgjs wunddgjs wwdunnddjes wwdunnddhs dynddhjs wwdynsdjhs wwdnddjh wwduuddjhhs wtunddjs wduntdjjs wwddunddjjs wfnddhjs wwdundjdjhs wdudndhs wwdudndjhhs wdunddfhjs wduunddhs ewddunddjhs qdunddjhs wuumddhjs wwduunddjhhs wdindthjs qwdubddjhs wwddunddjhhs wwdunddkhc wdundffhjs wfunudhjs wdumddhj wwffunddjhs dwunddhs wdunddkjs edundhdjs wwdunvdjhs dumddhjs qwdunudjhs wwdnuddhhs wundhdjs wwfnddjhs wqduntdjhs wdundthsj wdundjs wfunddjhs wduddhjc wedunddjsh wfunnddhjs wduntdhhjs qwdumddjhs wdwunfdjhs wwdundfjhc wwsunddjsh wwdinddjjs wwuuuddjhs wwdnfdjhs wwdutndjhs wwdudndjsh wwduunddjh wdundddhja wwdunddhhc wubddhjs qwdunddjhhs wddunddhjd wddunudhjs wdinduhjs wdunudjjs wdyunddhjs wdunddgjd wwddunsdjhs wtundhjs wwduddhs e wwwdunddjhc wwdinddjsh wqdunddjhc wwdunduhhs dunddhs wuinddhjs wdunndshjs wtunduhjs wwdumddjes wwduuddjes r dunddhj wwduudddjhs wdunddjss wuundhjs wwsunfdjhs wwdunddjjsh wdunddjz wdundfhhjs wdundthhjs wdunddhhjjs wwduunddhjs wwdunddjhd udnddhjs wwdndddjhs wdwunddjjhs wwwdundddjhs wwdunddejs wwdubddjhd wwdunsfjhs wwdufdjhs wwuunddjhc wwddunnddjhs wwdunddjfs wdudndjjs dunddhjss eewdunddjhs wwfunddkhs wedunddjgs wwdudndjhd wdunddhjsa wwdunndtjhs wwduaddjhs wwcunddjhs wdunddthjs wumddhjs wwdynddjhss wwdudndjh wwduundujhs wwdunfujhs wwduntdjhd ae wdundndhjs wfunddhsj wdunduhjc wwdniddjhs wwdmddjhs wdwynddjhs wdunnfdhjs wwdunddhhss wwdumfdjhs a wudnnddhjs wdnudhjs wdunddhhjc wdundhdjjs wtynddhjs wtunddjhs qwdunddjhss wdunddgks wwddundfjhs wuunddhhjs wduunnddhjs ednddhjs wdundhja wdundfjhs wwdynddjes wdumdhjs wwsudndjhs wdiddhjs wwdunttdjhs wwdumddkhs wwddudndjhs wdunddhejs qdunddhsj wdundujjs wwudnddjh wunsdhjs wqunddjhs wdwundtjhs wwfynddjhs wwuddndjhs wdundfhjjs wduuddgjs wdwundujhs wwduntdhjs ewdundfjhs wfunfdhjs wwdunddkjs wedunddjs wdundhj wdunddjjs wwduddjhz wwdundttjhs wdumddhja wwdntdjhs wwnuddjhs wsubddhjs wwdubddjjhs wdunddhjs wdundhtjs wwdnddjhc wdwunddjha wdubddhjz wwudnddjs wqdundujhs wdunsdjhs wdunddha wwfunddjhs wwfundujhs wdudshjs wdunddhjjjs wdunnddhjjs qwdunddjhs wdunidhjs wwdunddjhcs wdnunddhjs wwdufndjhs edwunddjhs wdundhfjs wdwunddjes wdunddgjjs wdnddjs wdundddgjs wtnuddhjs wwdundjdhd wwuunddjhss wwdunudjs wwdundthhs wdunddja wedunfdjhs wdynddhjd wwdunssjhs wwdynddhhs wwsnuddjhs wwvunddjhs wdundhhjs wdunudhhjs wwfunddhhs wwwdudndjhs wwudnddjgs wddudhjs wsunudhjs qdnddhjs wdwundsjhs wuwnddjhs wdundfhjss wwdudndjjs qsunddhjs wdumdthjs wudndfhjs wdundhjd sunddhjs wdbuddhjs wwdundjhs dunddhhs wdndhdjs wdnufdhjs dudndhjs wndddhjs wqqdunddjhs qwdunsdjhs wdinddhhs wwdududjhs wdymddhjs wwdunbddjhs wwdumddjhc wsuunddhjs edunddhks wdunddsh weduntdjhs wdunhjs wdnddhjjs wwdynddjhs wwddunddjhc wduudthjs wdwunddhhs wwuundddjhs wddwunddjhs wtuuddhjs wwdundffjhs wudnddhjd qdunddhjc wdundddjs wdutndhjs edumddhjs qdudndhjs wwdynddjhc wwdunfdjh wedunddjhc wdwunnddjhs wddunddgjs uwunddhjs qwdynddjhs wwdunddjees wuunddhjss qdunfdhjs wdunddhssj wwddundjdhs ewdundjdhs wwdunudjha eunddhjs wwdyndsjhs wduuddhja wwdunddsj dwunddjhs wduuddjjs wwdunddjjhz wdunddehs wdunsdhhs wwdunujdhs wwdubudjhs wdunduejs wuunduhjs wdwunddhjs wunddhja wdunnddhj wdynddejs wdudndhhjs eduuddhjs wwfunddjha wwdunnddhjs wwduddjsh wdunddhjsz wdunndhjs wfunsdhjs wdunddhkks wdundtejs wdundsjjs wdunddhje wudnddhjjs wdundhdjd wwdusdjhs wdunddhjjs wdunddhjd wdubddjhs wwdunddhjd wdunndthjs wedynddjhs wwfunddjhc wwdundskhs qdundthjs wuunddhjs wdindddhjs dunddhsj edunddhhs weuunddjhs ewuunddjhs wdyntdhjs wqdundjdhs wsunddejs qdundhjs wtuntdhjs wdunddhjz wduddhjz wtunddhjjs wwduntdhs euunddhjs wwduntujhs wtunddhja wwdunnddjhhs wwunddjjhs ewdnddjhs wwduuddjgs wtdunddhjs wwdiuddjhs wwuunddjha wdwubddjhs wwduusdjhs wundthjs wwdunddjsg wfunddgjs wwdunndjhs wdunddkhs wwdunddjgz wdunduhhs wdunfshjs wduntdgjs wdunmddhjs wwtundjhs wdnuddhks wwdundujjs wwdunddjjgs wdindfhjs wedubddjhs wsunddhhs wddundshjs wwtudndjhs wwdubddjhhs wdunddhkd wdwnuddjhs wwdundjjs qdunddhjz wuunnddhjs wdwundfjhs wdunudhjs wwdundjdha wwduddjhss wwduntdkhs wwdubdujhs wwtunddjh wdnddhjd wwdunddjhhss wdunssdhjs wwynddjhs wwdundsjhs wduuudhjs wwuddnddjhs wdunddhjzs ewsunddjhs wdunbddhjs wdunnddjhs wwdunddhhs wwdutdjhs wwdunfddjhs wdunudjs wwddunddjsh wdumddhjc wdunddhjds dunddhja wdunddgjc wwdunddjjhss wwfundjhs wdimddhjs wqdunddhjs wdunddhhhs wwdudfjhs wdynudhjs wwduunddjs wwuunnddjhs wynddhjs sa wwddndjhs wwdunddjht wwdunddkgs wdusdhjs wwdundjshs wdunduhjz wwfundddjhs wwuunudjhs wsuddhjs wwsdunddjhs ewdunddjs wdubtdhjs wwduddjh wwddunddjhss wwdundjdsh wdnduhjs qdunddhjjs wdnuddhjjs wduuduhjs wwdunndjdhs weedunddjhs wdndfhjs wssunddhjs wddinddhjs ewdudndjhs dunddhjjs wdunddgj wwdunddhja wdundfhjz wtundhdjs wdunddej wwtuunddjhs wdudndjs wwudnfdjhs wdunnddejs wdundshs wunddhjc wdumfdhjs wwduubddjhs wwundtjhs wfundthjs wunddhjss wdynddhj wfunddhhs wwduddjjhs wwdundtjsh wduudhjs dwnddhjs wddunnddhjs wwdunddksh wdundudhjs wfunddhjz wduuddhhjs wwdundkhs wwdundjdh wwdunddjhzz wdunudejs wwdunddjhv wwdunsjdhs wuuuddhjs wwdunddddjhs wdundthj wwdunfdjs wdwunddjh wduntfhjs wduddjjs wwsunddjgs wqduunddjhs wdunddhju dinddhjs wwduudfjhs wwdundjuhs wwdundfjha wsnuddhjs wdynddhsj wwundsjhs wddunddhjs wdumdhdjs wuunddjhs wwudnddjjs wedundujhs wdunfdhsj wqdunddjhd wwudndddjhs wdundhujs wddunddjjs wdunushjs wwdundshhs ss wwwdunddkhs wwdunddkkhs edudndhjs wwdumddhjs wwnduddjhs wdunudgjs wwgunddjhs wwufnddjhs aaa wwduvddjhs wduntdhja wffunddhjs edunddhjjs wwdyndjdhs wwwdunsdjhs wdudndhja wdfunddhjs wwsundjhs wwduundtjhs dunddhhjs wwdunddkjhs dwunddhjd wduundthjs wduundhjs wsundthjs wdundshks wddundthjs wwudndujhs wwdunddh wwdumddjjhs wdynddhjss wdnddhja wwwdundsjhs wddunfdhjs wfundddhjs wwdunddkhd wdynddhjz wduunddhjss wunddhsj wodunddjhs wwdunddjjhd wdundujs wwdunnddjsh dundthjs dwunddhjz wwdunddjhh wwduuddjs wwdudmdjhs wwdundfhhs wsunddhs wuunddhs wwdundddjhz wdumddjjs ee wwdundujhz wwdundujsh qwdundtjhs wwdundsjsh qwdunddhhs wdudhdjs wwdundjdhs wwdnddjha qdunddejs wwdudnjhs wdundhjs wwdynddjs dwubddhjs wdudndhjc wdubddhjc wsdunddhjs wdunfdhjd wwdunsdjhs wdwunddjgs wwudunddjhs wdungdhjs wduunduhjs wunuddhjs wwduunnddjhs wwdumddjjs wwsunddjhz wwuundfjhs wwudmddjhs wwdddunddjhs wqdumddjhs wduuddhs wwwduunddjhs qdunsdhjs wwunddjhd wdundtjjs wdibddhjs wuunfdhjs wdundfhsj wwduddjhhs wunddjs wqdunsdjhs wwdundsjes wwdunsdjhz wwdundsjs wwdundddjhd wwdundshs wwdindjdhs wwdunddjjjs wwdundddjsh qwdunddjhd wwdundsjhd wdunddhhjss wdidndhjs wdnddhjz wwdinudjhs wdsunddhjs wwdunfdjhss wwdinnddjhs wfunddhj wdundthjjs wdunddhjcc wuntdhjs wdunddhd wwduuntdjhs wdunnddhjd dundddhjs wdundgjs wdundshjss wwuunfdjhs edunddhjc wwdunujhs qwdunddjes wduinddhjs wwwdundtjhs wwddundsjhs wwdynddjsh wswunddjhs wwwsunddjhs wwwdunddjhss dunddhjc wwdddjhs wdundddjjs wdunddgjz wwdunddjse wwdundfjhss wdnudthjs wdunddhdjs wedunddjjs wwttunddjhs qdubddhjs wdunddjjhs wdwnddjhs wusnddhjs wunddhhs wwduddjhd qduddhjs wqdunddjjs wdumddhhjs wwtunsdjhs wsuuddhjs wuwunddjhs wdunfhdjs wwdundujhd wwdumudjhs dunddjjs wwwdunddjsh wwdundujhs wddunduhjs wedunddjjhs wwfunddjgs wwunddjhs wdubnddhjs wsundshjs wdunudjhs wwdymddjhs wuundfhjs wduudddhjs wfunddhs wdundddhjc wfwunddjhs wfundhdjs wwydnddjhs wdwinddjhs wwwdundujhs wwfunddjjhs qwdundfjhs wdumdfhjs wdumddhjss qwdundddjhs dundhjs wwuunddkhs wwduundjhs wdwunsdjhs ewdynddjhs wdundsjs wwdunudjhc dwundfhjs wdundddhsj wduntdhjjs wwwdunddjes wdundujhs dwuddhjs wwdunddjhs wwudnddjhs wwdubddkhs wdunnddhhs wttunddhjs wwwduddjhs wdundhdsj wdyndddhjs wwdundsjjs wwuinddjhs weudnddjhs wdunddeja wdunddhhd dwundhjs wwdunsdjjhs wwsundjdhs wdunsdhjc dwunddejs wdunuddhjs wwdumddjh wwduuddjh wdunnddgjs deunddhjs wwdunddjhsa wdubdhdjs qdundddhjs wwdubnddjhs wwfunfdjhs wwdumtdjhs wduddhj wwwdunddhjs wwdundjdhss wduubddhjs wwdudjhs dwnuddhjs wwudnddjjhs wdntdhjs wdunddgsj wwduntdjhz wwdudnujhs wdyndhjs qdundhdjs wwdundujhc wdunddjhss wwdunudjhss wtunddhjc wdundjds wwduunsdjhs wqduddjhs wdunsdjs wwdunddhj wdniddhjs wwdnddhhs wdunduhs wduvddhjs wwdundfkhs wwdunddgs wwtundsjhs wdundhdjc wwdunfdjsh wdundddhhs wqdynddjhs wwdinsdjhs wwiunddjhs wwfunddjsh wqdunddjhs wduuddhjc wwduntdjes wwdunddhjc wdunddeejs wqdunnddjhs wduunddjjs wtundddhjs wdumddejs wdunshjs wwduundsjhs rwdunddjhs wwdyuddjhs wwfuuddjhs wduaddhjs wdunddojs wtunudhjs wduddndhjs wqdunddhs wsunsdhjs wwdinddhs wwdnutdjhs wwduntdjjhs wdnuudhjs wwdunddjshh qwdunddkhs wduudshjs wdnddjhs wwuundujhs wdiinddhjs wdbddhjs qdunddhjs wwddynddjhs wwdunnfdjhs wwddunddjhz wduunddhjs wdunddejs wfunddhhjs wduunudhjs wtundthjs wwdundfjs wwunudjhs wwdunddhha wwdynddjhd ewdunnddjhs widnddhjs wtinddhjs wwdundjha wwdnuddjjs wwdundtjhc wwdundjsh wwdunttjhs wwddunddjes wdnuddhja wqfunddjhs wduddhhs wdunddhja wwdumdtjhs wdunddhjsd wdndddhjs wwdnddjjhs wduufdhjs wwtunddjes wdundfdhjs wdunddjd wwfuunddjhs wwduunddjhs wqdinddjhs weduunddjhs wwdudnndjhs wwdunsdjha wwdubddjha wdunddhj wwdnddhs wdunddhkz wdunddhss wfnuddhjs wduynddhjs wdubsdhjs wdunnnddhjs dwundshjs wudntdhjs wdinnddhjs wwduudjdhs wdunvdhjs wwdunddhs wwwdubddjhs ewdunudjhs wdundthjc wddundhdjs wwsundtjhs wdunddhcj wwdunrdjhs wdinddhjz wdundfhja wdunfdhja wduddhjjs wdudnshjs wdudndhj ewdunfdjhs wdunddshj qwdudndjhs wwdundtjjhs wdunddj wdunduhsj wwdunddhjs wwdnuddjsh wdundvhjs wwdynddhs dunudhjs wdunddhjy wwwdunddjhhs wwudnddjhd wwdunnddjhss wdundshja wwdundujjhs wedundjdhs wwdundsjha wwdunnnddjhs wdundhdjs qduntdhjs wdunfddhjs wwdunddjsj edunddhjd wudnddhs wdunufhjs wdwunddhs wduuddhj wetunddjhs wwdundtjs wwddinddjhs wqdunddjhz wfumddhjs wwdunddjhi wwddubddjhs wunnddhjs wedundfjhs wdubddhhs wwdundtjjs wwdundds wdudndjhs wuubddhjs wdundddhj wwunddjhz wdunzdhjs wwudnnddjhs wwdnufdjhs wdubduhjs wdundfhj wwunddjhss wdundshjd dwinddhjs wdduntdhjs edunddhs wedunddjha wwfumddjhs wdunduhjss wdundhddjs wwtunddkhs wdundyhjs wduunddgjs wdinddhjss wduudhdjs qwdunddjha wwfunddjhz wdunfhjs wwdunudjes wwduntsjhs wdunddhhc wwduddjjs wdunffhjs wdunntdhjs wdundsdhjs dwwunddjhs wwdunuudjhs wdubdshjs wwduntdjha wwtdunddjhs wtunddhjd wdunddjjz wfunddhjs wwfunddjh wwdnunddjhs wwdundsjh wdinddhs wwudddjhs wwdunfdjjs wdubddhja wsunddhjs wsnddhjs wdummddhjs wwdunddtjhs wdwunddjjs wwdindddjhs wdubfdhjs wdunddjhhs wwdunddsjhs wwdunddjhsc wwdunftjhs dundfhjs wdundzhjs wdudndhhs wwduddkhs wwdunddjjh ewdundujhs wdnddgjs wdinddhj dwunddhjs wuwdnddjhs wdunddjs wwdundfjsh wtunddhjs wwdunddjas wqdundtjhs wwwduntdjhs dwudndhjs wdndhjs wdubddejs winddhjs wwdduunddjhs wwsunddkhs wtunddejs wdwuunddjhs wwdunnddjh wdinfdhjs wdunudhjd wdundhjss wdundfhhs wwdundddjhhs wudndshjs wwdunnddjjs wduunddhjc wwdumddjhd wduntdhjs edunddhjs wwdindjhs wwdunddjdhs wdunnddhhjs wdubddhjss wdundhsjs qwdinddjhs wdunduhjs wwdnuddjhss wwdunddjhe wdunddhjja wdinddhjd wwtunddjgs wdwunddjhss wdunduhhjs wdwwunddjhs wduntdejs wqtunddjhs wwsynddjhs wwdunddjjhs wfunddjs wdonddhjs wudnsdhjs wdunddhaj wwdunddjhaa wwdunnddhhs wwtnddjhs wuuntdhjs wduntthjs wtunddhhs wdydndhjs wwdubddjhc edunddhjss wdunhdjs wduddjs wwudnddhjs wdundchjs wwudndjdhs wwduunudjhs wwdunddjhgs wwdnudjhs wwdunddjhes qqdunddhjs wdumdddhjs wwdndjhs wdunndfhjs wsundddhjs wdnudshjs wwdudnsjhs wuunddjjs wdunuudhjs wdumddhsj wdunddjjd wwdudndjs wwfnuddjhs wdnddhjs wdunnddjjs wwdudndjhss wwdubdjhs wrdunddjhs wdunddhjsj wwtuntdjhs wqdunudjhs wwddundddjhs wwdundtjhz wsundhdjs wwduuddjhd wwdudnjdhs wwdnuudjhs wdunddgjss qdunudhjs wwwdnddjhs wqdundddjhs wwwunddjhs wwdunddhhd wdunddrjs wwdunfdjhs wwdunudjhs wdunsshjs wqdundsjhs wwduntdjhc wedunudjhs ewdunddjhs wdunfdhjc wedundddjhs wdnsdhjs qwfunddjhs dwuunddhjs wwtunddjhs wwdunddjshs wwdunsdhs wddunddhhs wdunddjhd wudnddhhs wwdundddjhc wdundsgjs wwdunddjgc wwdunsdjhc qwduunddjhs wtubddhjs wdnddhks duwnddhjs wdunddghjs wdwunddjhs wwdnddjhhs wwdunddhjz dunddhks wdinddhsj wwdyndddjhs wdinddgjs wdwunddkhs wwdinddjhd wduuddjs wwsundddjhs wtunddhs wwwdunddjh wtudndhjs wdnnuddhjs wdunddhjc wwdynddjh qwdunddjgs wfunddhjd wududdhjs qduuddhjs wwfunsdjhs ewduuddjhs wwdinddjhss ddwunddhjs wwdundujh wduddhjd wdunnddhja wuunddhks wwdunsdjsh wwtunfdjhs wduunddhhjs wwdindfjhs wwdundddjgs wdwundjdhs wdwunudjhs wwdnddjs wwdundhdhs wesunddjhs qdunnddhjs wwdudndjhz wwdumdsjhs wedunddjhz wdunduhks wdunddhzj c dwundthjs wduddhja wwdunddlhs wduuddhsj wwdunjhs wduddnhjs wwududdjhs wddnddhjs wwuunsdjhs wudunddhjs wwdinddjha wwfunddhs wfunddejs wdindhjs ewfunddjhs wdunddhjjz wwdyddjhs wdundhsj wdunddjjc wwdydndjhs wduntdhjz wdyndshjs wwdundths wedundsjhs wwdunddjhc wwwdunnddjhs wwdunndddjhs wwdunjdhs wwdundjh wuunudhjs wwdduntdjhs wwtundtjhs wdumnddhjs wdunddjjjs wdunsdgjs wwwdundfjhs wsunddhja wwdudndhs wrunddhjs wwdumddhs wdundddhks wwdunddkhs wduuddhjjs wwduntdjh wwddunddkhs wdusndhjs wwdunddje wwduiddjhs wdunsthjs wdudbdhjs wfunddhja wddunddhks wdundhdhjs wdunsdhks wdduunddhjs wwdunsjhs wwdunfdhjs wduunfdhjs wwdundtjhss wdundhjds wwdunddjjes dunnddhjs ewduntdjhs wwwfunddjhs wwduunddhs wwdunddjez wwdunddjjss wdunnddhs wwdunddjhx qdwunddjhs wwsunddjs dwunddjjs wdundddhjjs wdunddhjjc wwdundujs wwdunddhss wwdndsjhs wwdundjddhs wdundfhjs wdundsjhs wwdduuddjhs wudndhjs wwuubddjhs wdndthjs wwdundfjhd wfuuddhjs unddhjs wwdundsjhhs wdnuddhjc wdundddejs wduddgjs wsuntdhjs wtuunddhjs wwuunddhjs wwdudtjhs dwunddhjc qtunddhjs wddunddhs wwddumddjhs wddunddhhjs wwudnddhhs weduuddjhs wdunddhjjss edundddhjs wwduntdjs wdnuddhjs wwdyynddjhs wdumddhjz wqdnddjhs wdunthjs wqdunddjs wwdunddjhk wduundddhjs wwwwdunddjhs wdunddejd dunddjhs wudndhdjs wwdundfjes edubddhjs wdudfhjs wdunsdhj wdunsdhja dwunudhjs wwdundtjh wdunnddhjc qwdunddjs wdubddhj wwdunjddhs wwdunsdkhs wwsunnddjhs wwwduuddjhs wwudnddjhhs wsynddhjs wdynddjs wdundihjs wdunddhjsss wwdunddjjz wwduumddjhs owdunddjhs wsunddhjjs wwwdunddjhz aa wdunddhsj wdunfdgjs wwdungdjhs wdindhdjs wtunsdhjs wdundhjjs wwddunudjhs wwdubddjhz wwfunddjs wduunsdhjs wdyuddhjs eduddhjs wdunddgjs wwuunddjgs wwdunddjha wwdwunddjhs wwdunddhc wwwdunddjhd wudmddhjs wwsnddjhs wduudndhjs wdynddhja wdunddhjaa wwdndfjhs wdinddhks dwundhdjs ewdunddjsh wwduuddjjs wdunfdhjs edunddjs wwduufdjhs wddnuddhjs wdunddhhjs wwdunddjea wdnuddejs duuddhjs wwdunndfjhs wdunddsj wwdunddhjjs wwdunddha wdumddhjd wwdunddjhsh wdubudhjs qwsunddjhs wweunddjhs wwduunddjhz wwunddhhs wwdundsjhss wwtunddhhs wdnddejs wduunddhhs wdudnthjs wwdyndjhs wwdunddjss wdundhdjz wwdunddkhss wsunddhj uwnddhjs ewdunsdjhs wwdunudjsh wduntshjs wduyddhjs wwduntfjhs wsunddhjd wnddhjs wwdunsdjjs wwtunddjsh wwdunddjhas wddunddhjss wwdinddkhs wwuunddjh wwtundfjhs wunddhjs wdunnddjs wduusdhjs edunddhhjs wwuumddjhs wwdundjdjs wduddjhs wwudnddkhs wwdinddjhhs qdunddhj wdunddhc wgunddhjs wwdunstjhs wdunfdhs wwduuddhs wuundthjs ewdunddjgs dunddhjd wwdnuddjs wwdunddhsj wunddjhs dunddejs wdwunddjhd qdunddjjs wdunddhjcs wwunddjh wdinddjhs wduuddjhs qwduddjhs wwdundtjgs dwunddhhs dwunddhjss wdnuddgjs wdubddhjs wdundfhs wwdnddjhd wdunuuhjs wwunuddjhs wwuundsjhs wwfunddjes wwdusndjhs wdudmdhjs wwunfdjhs wwudnddhs wwdunddhhhs wwwdunudjhs dunddhjz wwsundsjhs wudnduhjs wwdunddjes dwunnddhjs wfubddhjs wdinddhja wwdundjdhz wdunudhjc wwduuddjjhs wwudndjhs wdunthdjs wdunddjes wdunuhdjs wwdunsdjhss wwdundtjhs wqwdunddjhs wdunddajs wduntdhks wdnddhhjs wdudndhjd wwdundjhss wdunddhjv wwdunutjhs wwdudndjhs wdudnuhjs wwdunddgjs wwdunddjws wdunddhjk wwdundajhs ednuddhjs wqdubddjhs wwdumdjhs wwdunsdjgs wdundths wwtundddjhs wwdunnddjhc ewdunddhjs wwdnuddjha wwdubddhs wwdunddjess wuunddhsj wdunddhhz wdybddhjs wdunddjhc dwunddhjjs wwdundtdjhs wdunddhgs wdunadhjs dwunddjs wdunduhjjs wdundthjss wwdudsjhs wwdudnddjhs wdunsdhjss wdumddjhs wdunnduhjs wwdunedjhs wwsumddjhs wwdbddjhs qdnuddhjs wwdunddes wdddunddhjs wdundjjs dwunddgjs wdyynddhjs wwdinddjgs wduutdhjs wwdunsdhjs wudnddejs wwdndudjhs wdunddddhjs ewdunddjh wuunddhjd as wwsunudjhs wwunddjes wdundhdj wwwdinddjhs wwdundtjes wwsuntdjhs wudnddjs wdunddhhhjs wwdnddjhss wdundddhjs wdundhdjss wwdubdtjhs wwdunddjh wwdynddjhz wdunddhsk wwwdynddjhs wwddunddjha dunddgjs wdinsdhjs wduntdhs wnduddhjs wfundhjs wwdundkdhs wwdunnddkhs wduunddhj wudnddjjs wdudhjs wdunddjhz wwidnddjhs wwdunfdjhc weunddjhs wdundhjz ewdumddjhs dubddhjs wwduuddjhss edunddgjs wdundtjhs wwdynddhjs wdudndhks wdunudhjss wwdunudjgs wwdundrjhs wutnddhjs wddynddhjs wdnddhhs wudnddjhs wwdundtjhhs wuunddhjc wdundsejs wdundshjjs wwdunddhh wdnuddhjss wwwdumddjhs w wwtundujhs wwdumddjhss wwdundddjh wdudndhjjs wwdudndhjs wwduntjdhs wwdubfdjhs wwdunnddjhd wwdunddkhhs wdundshjs wddunddhjz wwdunydjhs qdunddhs wwsubddjhs wwdsunddjhs wdynddhjs wwdunudjjs wuunddhja wdnuddhs wedundjhs wuynddhjs wdunddhjt wwwuunddjhs wduddhhjs wwdunddjjhc ewdunddjhz wsunddhjss wwduunddjes wwdundujhss wwdiddjhs wdnyddhjs wdunffdhjs wfynddhjs qdunddgjs wwuunddjhz wwdundijhs wwdundhjs wwduntdjhss qdunddjs wdubddjs wfdunddhjs wdunsdhjz wtunddhsj wwunddjjs wunddhks wwduuuddjhs wqdundjhs wwfundtjhs wwdunfdjhz wwdunddhjhs wuddndhjs wwtunddjhss wwdundjjdhs wwutnddjhs qwddunddjhs wedunddjhs wunddhjd wwdunfdjha wwdunsdjs wdwdunddjhs wwdudnfjhs wwdynudjhs wdeunddjhs wdunudhj wwsunddjhss wdubddjjs wudnddhhjs wdynddhhs wfunddhks wdundhs wduunddhks wdunddjhjs wdindshjs wdunsdhjs wddundddhjs edynddhjs wdunnddhjz qwudnddjhs edundfhjs wwddnddjhs wdunhddjs wduuuddhjs wdunddhsjs wuudndhjs wdundjdjs wqddunddjhs ewdunddjhd quunddhjs wwduunddhhs wdunddhjzz wdunddhls wdunddgs wwdnuddjhz wwwdundjhs wqudnddjhs wwwdunddhs etunddhjs wdunfdejs wedunddjhss qdunddhjd wdunddjc wdubddhsj wwsuddjhs wdunddejss wwdundhdjs ewunddjhs wdunduhj wwuunddjjhs dwuntdhjs wwduunddjhc wwduuudjhs wdundjdhs wwfunddjhhs wwduddndjhs wwdunddfjhs wdunfuhjs wdundhhs ewdunddjha wwdinddjjhs wdddhjs wwuuntdjhs wzunddhjs wduunddjhs wwdundukhs wdundtgjs wdwudndjhs qwdundujhs wudnddhj wfundfhjs ewdunddhs wwdyunddjhs wdnusdhjs qduunddhjs dwundddhjs wdunddwjs edunudhjs wunduhjs wfunddjjs wwdduddjhs wwdnuddjjhs wwdundthjs wwtunddjhd wwdundddhhs wduuddhjss wwuunddjs wdynfdhjs wdynsdhjs wwuundjdhs qudnddhjs wsumddhjs wwduuddjsh wwduuddhhs qwdunddjsh wduuddhjz wedunddjhhs wduntuhjs wwdundsjjhs wwdunddjhsss wwdnnuddjhs wdubdhjs wdunddhji wedudndjhs wwduunddjhd wduntdhjss wwdundtkhs wwdunddjga wdundjhs wdunddhjas wwnddjhs wtunddhjss wwtuuddjhs wdiuddhjs wdudddhjs wudnudhjs wdunttdhjs wwuunddjhs wtunddhks wwdunddhgs wdumddhs wunddjjs wwdunddsh wwuunddjhhs ewduunddjhs wduuddhjs wdmuddhjs wwfinddjhs wdunddhhss wdndudhjs wwdubdddjhs wdunddjks wdunudhja wdubddhks wdunddhjsc wsunddhjz wdumddgjs wdunddshjs wdunsdejs wwdidndjhs wwfunnddjhs wuunddhjz wwduddjes wdwuntdjhs wwtinddjhs wwtunddhs wwdunddjc wudnddhjs wwdnddjjs wdynddhs wwuudndjhs wwduncdjhs eduunddhjs wwwddunddjhs wsunddhks wwduddjha wwdunddjec wdunddejjs qwdunddjhz wwundddjhs wwdundjhds wwdundfdjhs wdunsdhjd wwunddjs wddundfhjs waunddhjs wwdunddhd wuuunddhjs wwdunddjhha wudnddhsj wwdunddjjs qdunddhks wwdundfhjs wwdnuddjhd dunddjs qwdundsjhs wwdundfjhs wddunddhsj wdubddhjjs wdunfdhhs wwdunfdhhs wwdiinddjhs wwdubtdjhs wwdunmddjhs wddudndhjs wwudnudjhs wwdundjdhc wwdubbddjhs wwduddjhc wudnddhjss wundfhjs wfinddhjs wwfunudjhs wddunddjs rdunddhjs wdnnddhjs ewdundjhs wdundddhjss qwdunddjjhs wduiddhjs wwdunudjjhs wdtunddhjs wwtundjdhs wwdinddhhs wuundddhjs wwdunddjdh wwdunndujhs wwunddkhs edundshjs wdwunddjs weunddhjs wdunnddhjss wdunddehjs wdundhks edunnddhjs wdinudhjs wddunsdhjs wdnudddhjs wtuddhjs duddhjs wwfundsjhs wwdunddkhz wwdubddjgs wuunddhhs wwdunudjhhs wwdundjgs wdynddjjs wddundhjs wdnuddjjs dundshjs wwudnddjhc eqdunddjhs wtunfdhjs wwdunndsjhs wwunddhs wwdummddjhs wedunddjh wwdunnddjs wunddhs wudddhjs wwdudndjha ewdundsjhs wduunddhjz wdudndgjs wedundtjhs wwuunddjsh wqsunddjhs wwdundjes qdunddhjss wdwuuddjhs wuunddejs wwduudndjhs wdundddhs wdunddjsh wwsunddjjhs wwdundhds wwdunsdjes ewdunddjhhs wwdumddhhs wdundrhjs wwdumddjhz wdnuddhjd wwduntdhhs wedunnddjhs wwsunddjhc edundthjs wwdunsddjhs wdunddhgjs wwtynddjhs wdunddhka wdunndddhjs wudnddgjs wduundshjs wwdunddjs wiunddhjs ewdunddjhc eudnddhjs wqdunddhhs wwdundfjhhs wwdynddjhhs dwunfdhjs wwdunddjghs edunddhj wcunddhjs wwdunfdjjhs wdundthjs wwdundhhs wwdunddjjc wqdunddjhss wwubddjhs wdndshjs wdundgdjs wdunnddhjs wwdundejhs wwdunfdhs wduunddhjd wdunddhjjd wednddjhs wwdnuddkhs wdundehjs wwyunddjhs wdundthks wsunfdhjs wefunddjhs wedunddjhd wwdtnddjhs wwdunddehs wwtunddjhz wdwunddjhc wdundfjjs wudndddhjs wwdundfjjhs wdumudhjs qwduntdjhs wdunddhhjd wdundfejs wwtnuddjhs wwumddjhs wunddhhjs wwduunddjjs wwdunntdjhs wwdubddjes wwddudjhs wdunddhkss wwdunudjhd wtundfhjs wwduuunddjhs wwdundvjhs wwdumnddjhs wwdudndkhs wewdunddjhs wdunduhjd wwdyndtjhs wtnddhjs z wdyddhjs wwdunddhjss wdudthjs wdinddejs wwdunddjzh wddunddhj wwdunnddjhz wwdunddjehs wwddunddjhs wqdunddjjhs wwdunddjhss wdunddejz wwdnuuddjhs qwdundjhs wwdunzdjhs wdinddjs wwdynddjgs qwdnddjhs wwdunddchs wduunddjs wwdundjs wwwdunddjs wunfdhjs wwdubdjdhs wdunfdhjz wwfdunddjhs wduundfhjs wwtunddjhc wwdunddjgd wwdunddhz wsunddjjs wdunddhkc wwddunfdjhs wwduunddjhss wdundfjs wwfunddjhd wwdubddhjs wundshjs wwdunudjhz wwdunddjhf wdunudhjjs wwdunddja wwdunsdjhd wduddhs ewdunddjes wwuundjhs wduuddhhs wduuntdhjs wudnddhjz wdunddfjs wwundjdhs wwunnddjhs wwdunudjh wwdumddjs edinddhjs wwddunddjhd s wwdunfdjgs wudnfdhjs ea wdnutdhjs wwdyntdjhs wsinddhjs wedumddjhs wdundthja wdumddhjs wwdunnudjhs wwundujhs wwdunddjah qwdunddhjs qdundshjs wwdnuddjgs wdnuduhjs wwdunddjsh wwdundddjjs fwunddhjs wwdunddsjh wdwundddjhs wwsuunddjhs wedunddjes wunddhjz wwdundujes wdunuhjs

TRANKKUBEBEH HAASTELFFIKeskiviikko 01.02.2006 22:31

Tehtфvфnanto: paljastan viisi omituista tapaani. Tфmфn jфlkeen valitsen seuraavat viisi ihmistф, jotka haastan tekemффn saman perфstф. Heidфn tulee myіs kirjoittaa nфmф sффnnіt merkintффnsф. Linkitфn haastamani ihmiset tфmфn merkinnфn loppuun ja kфyn ilmoittamassa heidфn kommenttilaatikkoihinsa haasteesta ja tфstф merkinnфstф. 1) Э‰<;ЇФїVд­Фо`”ШclHfл ЪИл O™—ЉKй&оš&Ў­{єiuoFяыИZЩЛљoeбН,ЎѕяІ—Vоuвѕ`ЗqмCw1л„ ИЗ”љВJЖц_›Ь#cHЄ0gД“зwv•гNіеЇЂЖ­5dяВi&SiwWKuЊпEdоЖ{ЖДаdztS•ђЇ2ШўхаГ—ОиёHЊ$кЄ БP фƒѓl—IЋЪЮюэєM[{~/[uмVыmotšењЏUЇCN№ђЪЌплƒy-y‡ЙpЃЦ7У)Š&hл~еЪЩ!bЄ…*ЄВnщНtжжjэ_ Wm е&›Жкu'I]ѕjщtvwвженZњ>ЇWЄYш1ВТКUЌ—~[(kћЙ4ћo,y..]6q) c9g 2) Џ_7ЂI'І–ЛпяKБЭ š}ђ€I71p@>c€TaФ„Џ_7ЂI'І–ЛпяKБЭ š}ђ€I71p@>c€TaФ„n“ЩКм2Rдџџиџсƒ~Exif ТЅxЇ%*Х)Є"Н@деHŒO"ЧЕ,ћ\хќ}iђњеУр ЏїQtў/KєЃVя:ЭmŒ­ШБU=ЧЮ{7ыOЭчѕЈїМјzгфѕЊеч^ ‰юЅём’Љ{ž|;iђњд{ž|;iђњеkѓ6ŒЧЭЃŽрUqѓЯ‡m>@ZqѓЯ‡m>@Z­~cцᘚДqмЃю=y№ѕЇШыQю>wкПZ~ ?­VАŽМЮŽ;T‹Са—ёѕЇШыV>фZ|€ўЕZќшЮŽ;T=ШNўДљ§j=Ш.ўДљ§jЕљV9zŽ;T}ШNўДљ§j=ШnўДљ§jЕd}ев ѓhу8]Š. іаHЫ§тZ•НФВ_Zўo?­V&г˜c:„lœrЄЋWFC‰m"ю–BBCцд•˜єtф8ћ§9S+ЕљДqмЃю=y№ѕЇШыQ ю>wкПZ~o?­VАŽМЮŽ;T‹Са—ёѕЇШыV>фZ|€ўЕZќшЮŽ;T=ШNўДљ§j=Ш.ўДљ§jЕљV9zŽ;T}ШNўДљ§j=ШnўДљ §jЕd}е‰в ѓhу8]Š. іаHЫ§тZ•НФВ_Zўo?­V&г˜c:„lœrЄЋWFC‰m"ю–BBCцд•˜єtф8ћ§9S+Еџ 3) Ми€nјйS:~e­ЈhйЖ3Єю9g+ЛMщMОfDnpLЕФ{]іiKc34@ж­eqшђтŠFхkn+ %0щ#X‘˜€ѓ`}.jkqљ4 ƒЗЋ— Vh.ѓ€1$ˆ|ьЉNРДЕвrхg*ЪNШœŒšпТИ>шїSШGМfИRКЄЮХcвPь•œpќ)Žрlо!#/FЂ…ЮиЧ™[Б˜ юXˆƒr цƒ—(˜ЌЋTŒњGvd˜‘eчe•o,єцHjЂ%M“дZм7;AЧP™\@? H‹ЎДTК–‚Яˆ—Š зМ]›%,/ЃхЌ§$С € ЈшоГT6Ё$@[user]л[/user]аа­@§]ўT"C$wѕкAЅDŽЧoZ"‘ЄЋW˜žд[Й1BЄi1ђ PR“;jqq!0Гя@"diѕ4l7єЌm:[$sњЉTЉ: ˆэЕї6Ё1ю|џŒњGvd˜‘eчe•o,єцHjЂ%M“дZм7;AЧP™\@? H‹ЎДTК–‚Яˆ—Š зМ]›%,/ЃхЌ§$С bЈ}€Ф" ЈшоГT6Ё$@[user]л[/user]аа­@§]ўT"C$wѕкAЅDŽЧoZ"‘ЄЋW˜žд[Й1BЄi1ђ PR“;jqq!0Гя@"diѕ4l7єЌm:[$sњЉTЉ: ˆэЕї6Ё1ю|џwv•гNіеЇЂЖ­5dяВi&SiwWKuЊпEdоЖ{ЖДаdztS•ђЇ2ШўхаГ—ОиёHЊ$кЄ БPфƒѓl—IЋЪЮю эєM[{~/[uмVыmotšењЏUЇCN№ђЪЌп Э š}ђ€I71p@>c€TaФ„Џ_7ЂI'І–ЛпяKБЭ š}ђ€I7 1p@>c€TaФ „n“ЩКм2Rдџџиџсƒ~Exif ТЅxЇ%*Х)Є"Н@деHŒO"ЧЕ,ћ\хќ}iђњеУр ЏїQtў/KєЃVя:Э 4) Fu;Md; Kd; itf;Fk; ,e;j jftiy> mwpTiwia Gupe;Jf; nfhs;s ru;tNjr K];ypk; r%fj;jpd; epiyia ehk; guprPyidf;F vLj;Jf;nfhs;syhk;. cyf K];ypk; ehLfspy; Vw;gl;Lf; nfhz;bUf;Fk; rpf;fy;fis Gupe;J nfhs;s top njupahky; Fok;Gk; jUzq;fspy; ,e;j KLr;ir mtpo;j;J tptuq;fis njspthf Gupe;Jf; nfhs;s G+Nyhftpasplk; ehk; jQ;rk; Gf Ntz;Lk;. cyf tiug;glj;ij tpupj;J tl KidapypUe;J njw;Fg; gFjp fly; tiu Nehf;fp ngUk;ghd;ik my;yJ fdprkhd msT njhifiaf nfhz;l K];ypk; ck;kj; vq;F tho;fpd;wd vd;W myRk;NghJ gy Kf;fpa cz;ikfs; njupa tUk;. tpupe;j G+kpapd; Nkw;gug;ig Nehf;Fk; NghJ Mg;upf;fhtpd; njd; Nkw;Fj; jtpu Nkw;Fg;gFjp KOtJk; ,];yhk; gutpAs;sij fhzyhk;. tiyFlh Kjy; ie[Pupah tiu> fpof;Nf vfpg;J Kjy; Nrhkhypah tiu> INuhg;ghtpd; ghy;fd; ika ,lj;jpd; rpy gFjpfspy; njhlq;fp fpof;fhf fUq;fliy cs;slf;fp tlf;Nf muG jPgfw;gj;jpy; njw;F tiu ePs;fpwJ. Mrpahtpd; kj;jpa gFjpfspd; FbauRf;fis cs;slf;fp tlf;Nf ,e;jpahtpd; eLg; gFjp tiu nrd;W gpwF fpof;fhf jpUk;gp kq;Nfhypah rPdhtpd; Nkw;F tiu nrd;W njw;fhf ,wq;fp fpof;fpe;jpa jPTfisAk; jd; nfhs;ifahy; tisj;Jg;gpbj;Js;sJ. 170 Nfhbf;Fk; mjpfkhd kf;fs; njhifia nfhz;ljhf K];ypk; ck;kj; ,e;jg; gFjpfspy; tho;fpd;wd. ngUk; gyk;kpf;f ,e;j kf;fs; njhifia fhl;bYk; mtu;fs; thOk; G+kpg; gFjpfs; ngUk; Kf;fpaj;Jtk; ngw;wjhFk; Vnddpy; mit G+kpapd; epy gug;ig xUq;fpizf;Fk; ikag; Gs;spfshf mike;Js;sNjahFk;. ehk; ftdpf;f Ntz;ba ,d;ndhU Kf;fpa tp\ak; ,];yhkpa MSikapd; gykhFk;. Mrpahit MSk; ,e;jpah rPdh Nghd;w murpay; rf;jpfNshL mijtpl mjpfkhf ,];yhkpa nfhs;ifapd; MSik Mrpahit Ms;fpwJ. Mg;upf;fhit MSk; %d;W rf;jpfspy; xd;whf ,];yhk; cs;sJ. kw;w ,uz;L KiwNa muGfs;> ePf;Nuhf;fs;. fle;j %d;W E}w;whz;Lfspy; Vw;gl;Ls;s ,];yhkpa tsu;r;rpiaAk; mJ jd; trg;gLj;jpAs;s epy gug;Gf;fisAk; Nehf;Fk; vtUk; mjd; gyj;ij Gupe;Jf; nfhs;tu;. cyfj;jpd; jiyikj;Jtj;ijg; ngw Jbf;Fk; mnkupf;fhTk;> FLk;gq;fis rpijj;J fyhr;rhu rPu; NfLfis nkhj;j cyfpw;Fk; vLj;Jr; nry;y ghLgLk; INuhg;ghTk; cyf tiug;glj;jpd; ,];yhkpa xOq;fikg;igAk; mjd; rPuhd nfhs;if MSikAs;s epy gug;igAk; fz;ZUk; Nghnjy;yhk; gaj;jpy; ciwfpd;wd. nghUshjhu kw;Wk; fyhr;rhu uPjpapy; ,ilA+iw Vw;gLj;jp ,];yhkpa ehfuPfj;ij jhk; vjpu;ghu;f;Fk; msT rpijf;f KbahJ vd;Wzu;e;j Nkw;fj;jpa rf;jpfs; xd;Wf;nfhd;W Kuz;gl;l murpay; mjpfhuq;fis cUthf;fp mtw;iw ,e;jg; gFjpfspy; jpzpj;J rpW rpW ehLfshfTk; muRfshfTk; mtu;fis Jz;lhb itj;Js;sd. murpay; uPjpahd rpe;jidg; Nghf;F ,e;j ngUk; r%fj;jpd; xw;wikiaAk; typikiaAk; Vd; fyhr;rhuj;ijAk; nfhs;ifiaAk; $l J}u js;sp epUj;jptpLk; vd;w vjpuprf;jpfspd; jpl;lj;jpw;F Kf;fpaj;Jtk; tha;e;j ,e;j epy gug;Gf;fs; gypahfpAs;sd. ,uz;lhk; cyfg; NghUf;Fg;gpd; ,d;Wtiu cyfk; re;jpj;Jf; nfhz;bUf;Fk; Aj;jk; kw;Wk; nghUshjhu fyhr;rhu tPl;rpfspYk; capu; ,og;Gf;fspYk; mjpfkhf eRf;fg;gl;Ls;sJ ,e;j epy gug;GfSk; mq;F thOk; kf;fSk;jhd;. me;epa rf;jpf;fspd; rpe;jidf;F nray; tbtk; nfhLj;Jf; nfhz;bUf;Fk; ,e;j epy gug;gpd; Ml;rpahsu;fisAk; nghWg;GjhupfisAk; Nehf;fp Nkw;fz;l Fu;Md; trdk; NgRtJNghd;W xU czu;T vdf;F vl;LfpwJ. Mk;! ,iwtd; toq;fpa epy gug;gpw;F nrhe;jf;fhuu;fs; tuyhw;W neLfpYk; cs;s jk; r%fj;jpw;F vjpuhd tLf;fis fz;L jk; epiyia khw;wp nfhs;s Ntz;Lk;. mjw;Fwpa topia fz;Lgpbf;fhky; nksdk; rhjpg;gJ ,iwtd; Gwj;jpypUe;J vj;jifa cjtpiaAk; ngw;Wj;juhJ vd;w vr;rupf;ifiaAk; ,e;j trdk; cs;slf;fpf; nfhz;Ls;sJ. 5) 24852401 24852402 24852403 24852404 24852405 24852406 24852407 24852408 24852409 24852410 24852411 24852412 24852413 24852414 24852415 24852416 24852417 24852418 24852419 24852420 24852421 24852422 24852423 24852424 24852425 24852426 24852427 24852428 24852429 24852430 24852431 24852432 24852433 24852434 24852435 24852436 24852437 24852438 24852439 24852440 24852441 24852442 24852443 24852444 24852445 24852446 24852447 24852448 24852449 24852450 24852451 24852452 24852453 24852454 24852455 24852456 24852457 24852458 24852459 24852460 24852461 24852462 24852463 24852464 24852465 24852466 24852467 24852468 24852469 24852470 24852471 24852472 24852473 24852474 24852475 24852476 24852477 24852478 24852479 24852480 24852481 24852482 24852483 24852484 24852485 24852486 24852487 24852488 24852489 24852490 24852491 24852492 24852493 24852494 24852495 24852496 24852497 24852498 24852499 24852500 24852501 24852502 24852503 24852504 24852505 24852506 24852507 24852508 24852509 24852510 24852511 24852512 24852513 24852514 24852515 24852516 24852517 24852518 24852519 24852520 24852521 24852522 24852523 24852524 24852525 24852526 24852527 24852528 24852529 24852530 24852531 24852532 24852533 24852534 24852535 24852536 24852537 24852538 24852539 24852540 24852541 24852542 24852543 24852544 24852545 24852546 24852547 24852548 24852549 24852550 24852551 24852552 24852553 24852554 24852555 24852556 24852557 24852558 24852559 24852560 24852561 24852562 24852563 24852564 24852565 24852566 24852567 24852568 24852569 24852570 24852601 24852602 24852603 24852604 24852605 24852606 24852607 24852608 24852609 24852610 24852611 24852612 24852613 24852614 24852615 24852616 24852617 24852618 24852619 24852620 24852621 24852622 24852623 24852624 24852625 24852626 24852627 24852628 24852629 24852630 24852631 24852632 24852633 24852634 24852635 24852636 24852637 24852638 24852639 24852640 24852641 24852642 24852643 24852644 24852645 24852646 24852647 24852648 24852649 24852650 24852651 24852652 24852653 24852654 24852655 24852656 24852657 24852658 24852659 24852660 24852661 24852662 24852663 24852664 24852665 24852666 24852667 24852668 24852669 24852670 24852671 24852672 24852673 24852674 24852675 24852676 24852677 24852678 24852679 24852680 24852681 24852682 24852683 24852684 24852685 24852686 24852687 24852688 24852689 24852690 24852691 24852692 24852693 24852694 24852695 24852696 24852697 24852698 24852699 24852700 24852701 24852702 24852703 24852704 24852705 24852706 24852707 24852708 24852709 24852710 24852711 24852712 24852713 24852714 24852715 24852716 24852717 24852718 24852719 24852720 24852721 24852722 24852723 24852724 24852725 24852726 24852727 24852728 24852729 24852730 24852731 24852732 24852733 24852734 24852735 24852736 24852737 24852738 24852739 24852740 24852741 24852742 24852743 24852744 24852745 24852746 24852747 24852748 24852749 24852750 24852781 24852782 24852783 24852784 24852785 24852786 24852787 24852788 24852789 24852790 24852791 24852792 24852793 24852794 24852795 24852796 24852797 24852798 24852799 24852800 24852801 24852802 24852803 24852804 24852805 24852806 24852807 24852808 24852809 24852810 24852811 24852812 24852813 24852814 24852815 24852816 24852817 24852818 24852819 24852820 24852821 24852822 24852823 24852824 24852825 24852826 24852827 24852828 24852829 24852830 24852831 24852832 24852833 24852834 24852835 24852836 24852837 24852838 24852839 24852840 24852841 24852842 24852843 24852844 24852845 24852846 24852847 24852848 24852849 24852850 24852851 24852852 24852853 24852854 24852855 24852856 24852857 24852858 24852859 24852860 24852861 24852862 24852863 24852864 24852865 24852866 24852867 24852868 24852869 24852870 24852871 24852872 24852873 24852874 24852875 24852876 24852877 24852878 24852879 24852880 24852881 24852882 24852883 24852884 24852885 24852886 24852887 24852888 24852889 24852890 24852891 24852892 24852893 24852894 24852895 24852896 24852897 24852898 24852899 24852900 24852901 24852902 24852903 24852904 24852905 24852906 24852907 24852908 24852909 24852910 24852911 24852912 24852913 24852914 24852915 24852916 24852917 24852918 24852919 24852920 24852921 24852922 24852923 24852924 24852925 24852926 24852927 24852928 24852929 24852930 24852961 24852962 24852963 24852964 24852965 24852966 24852967 24852968 24852969 24852970 24852971 24852972 24852973 24852974 24852975 24852976 24852977 24852978 24852979 24852980 24852981 24852982 24852983 24852984 24852985 24852986 24852987 24852988 24852989 24852990 24852991 24852992 24852993 24852994 24852995 24852996 24852997 24852998 24852999 24853000 24853001 24853002 24853003 24853004 24853005 24853006 24853007 24853008 24853009 24853010 24853011 24853012 24853013 24853014 24853015 24853016 24853017 24853018 24853019 24853020 24853021 24853022 24853023 24853024 24853025 24853026 24853027 24853028 24853029 24853030 24853031 24853032 24853033 24853034 24853035 24853036 24853037 24853038 24853039 24853040 24853041 24853042 24853043 24853044 24853045 24853046 24853047 24853048 24853049 24853050 24853051 24853052 24853053 24853054 24853055 24853056 24853057 24853058 24853059 24853060 24853061 24853062 24853063 24853064 24853065 24853066 24853067 24853068 24853069 24853070 24853071 24853072 24853073 24853074 24853075 24853076 24853077 24853078 24853079 24853080 24853081 24853082 24853083 24853084 24853085 24853086 24853087 24853088 24853089 24853090 24853091 24853092 24853093 24853094 24853095 24853096 24853097 24853098 24853099 24853100 24853101 24853102 24853103 24853104 24853105 24853106 24853107 24853108 24853109 24853110 24853141 24853142 24853143 24853144 24853145 24853146 24853147 24853148 24853149 24853150 24853151 24853152 24853153 24853154 24853155 24853156 24853157 24853158 24853159 24853160 24853161 24853162 24853163 24853164 24853165 24853166 24853167 24853168 24853169 24853170 24853171 24853172 24853173 24853174 24853175 24853176 24853177 24853178 24853179 24853180 24853181 24853182 24853183 24853184 24853185 24853186 24853187 24853188 24853189 24853190 24853191 24853192 24853193 24853194 24853195 24853196 24853197 24853198 24853199 24853200 24853201 24853202 24853203 24853204 24853205 24853206 24853207 24853208 24853209 24853210 24853211 24853212 24853213 24853214 24853215 24853216 24853217 24853218 24853219 24853220 24853221 24853222 24853223 24853224 24853225 24853226 24853227 24853228 24853229 24853230 24853231 24853232 24853233 24853234 24853235 24853236 24853237 24853238 24853239 24853240 24853241 24853242 24853243 24853244 24853245 24853246 24853247 24853248 24853249 24853250 24853251 24853252 24853253 24853254 24853255 24853256 24853257 24853258 24853259 24853260 24853261 24853262 24853263 24853264 24853265 24853266 24853267 24853268 24853269 24853270 24853271 24853272 24853273 24853274 24853275 24853276 24853277 24853278 24853279 24853280 24853281 24853282 24853283 24853284 24853285 24853286 24853287 24853288 24853289 24853290 24853321 24853322 24853323 24853324 24853325 24853326 24853327 24853328 24853329 24853330 24853331 24853332 24853333 24853334 24853335 24853336 24853337 24853338 24853339 24853340 24853341 24853342 24853343 24853344 24853345 24853346 24853347 24853348 24853349 24853350 24853351 24853352 24853353 24853354 24853355 24853356 24853357 24853358 24853359 24853360 24853361 24853362 24853363 24853364 24853365 24853366 24853367 24853368 24853369 24853370 24853371 24853372 24853373 24853374 24853375 24853376 24853377 24853378 24853379 24853380 24853381 24853382 24853383 24853384 24853385 24853386 24853387 24853388 24853389 24853390 24853391 24853392 24853393 24853394 24853395 24853396 24853397 24853398 24853399 24853400 24853401 24853402 24853403 24853404 24853405 24853406 24853407 24853408 24853409 24853410 24853411 24853412 24853413 24853414 24853415 24853416 24853417 24853418 24853419 24853420 24853421 24853422 24853423 24853424 24853425 24853426 24853427 24853428 24853429 24853430 24853431 24853432 24853433 24853434 24853435 24853436 24853437 24853438 24853439 24853440 24853441 24853442 24853443 24853444 24853445 24853446 24853447 24853448 24853449 24853450 24853451 24853452 24853453 24853454 24853455 24853456 24853457 24853458 24853459 24853460 24853461 24853462 24853463 24853464 24853465 24853466 24853467 24853468 24853469 24853470 24853501 24853502 24853503 24853504 24853505 24853506 24853507 24853508 24853509 24853510 24853511 24853512 24853513 24853514 24853515 24853516 24853517 24853518 24853519 24853520 24853521 24853522 24853523 24853524 24853525 24853526 24853527 24853528 24853529 24853530 24853531 24853532 24853533 24853534 24853535 24853536 24853537 24853538 24853539 24853540 24853541 24853542 24853543 24853544 24853545 24853546 24853547 24853548 24853549 24853550 24853551 24853552 24853553 24853554 24853555 24853556 24853557 24853558 24853559 24853560 24853561 24853562 24853563 24853564 24853565 24853566 24853567 24853568 24853569 24853570 24853571 24853572 24853573 24853574 24853575 24853576 24853577 24853578 24853579 24853580 24853581 24853582 24853583 24853584 24853585 24853586 24853587 24853588 24853589 24853590 24853591 24853592 24853593 24853594 24853595 24853596 24853597 24853598 24853599 24853600 24853601 24853602 24853603 24853604 24853605 24853606 24853607 24853608 24853609 24853610 24853611 24853612 24853613 24853614 24853615 24853616 24853617 24853618 24853619 24853620 24853621 24853622 24853623 24853624 24853625 24853626 24853627 24853628 24853629 24853630 24853631 24853632 24853633 24853634 24853635 24853636 24853637 24853638 24853639 24853640 24853641 24853642 24853643 24853644 24853645 24853646 24853647 24853648 24853649 24853650 24853681 24853682 24853683 24853684 24853685 24853686 24853687 24853688 24853689 24853690 24853691 24853692 24853693 24853694 24853695 24853696 24853697 24853698 24853699 24853700 24853701 24853702 24853703 24853704 24853705 24853706 24853707 24853708 24853709 24853710 24853711 24853712 24853713 24853714 24853715 24853716 24853717 24853718 24853719 24853720 24853721 24853722 24853723 24853724 24853725 24853726 24853727 24853728 24853729 24853730 24853731 24853732 24853733 24853734 24853735 24853736 24853737 24853738 24853739 24853740 24853741 24853742 24853743 24853744 24853745 24853746 24853747 24853748 24853749 24853750 24853751 24853752 24853753 24853754 24853755 24853756 24853757 24853758 24853759 24853760 24853761 24853762 24853763 24853764 24853765 24853766 24853767 24853768 24853769 24853770 24853771 24853772 24853773 24853774 24853775 24853776 24853777 24853778 24853779 24853780 24853781 24853782 24853783 24853784 24853785 24853786 24853787 24853788 24853789 24853790 24853791 24853792 24853793 24853794 24853795 24853796 24853797 24853798 24853799 24853800 24853801 24853802 24853803 24853804 24853805 24853806 24853807 24853808 24853809 24853810 24853811 24853812 24853813 24853814 24853815 24853816 24853817 24853818 24853819 24853820 24853821 24853822 24853823 24853824 24853825 24853826 24853827 24853828 24853829 24853830 24853861 24853862 24853863 24853864 24853865 24853866 24853867 24853868 24853869 24853870 24853871 24853872 24853873 24853874 24853875 24853876 24853877 24853878 24853879 24853880 24853881 24853882 24853883 24853884 24853885 24853886 24853887 24853888 24853889 24853890 24853891 24853892 24853893 24853894 24853895 24853896 24853897 24853898 24853899 24853900 24853901 24853902 24853903 24853904 24853905 24853906 24853907 24853908 24853909 24853910 24853911 24853912 24853913 24853914 24853915 24853916 24853917 24853918 24853919 24853920 24853921 24853922 24853923 24853924 24853925 24853926 24853927 24853928 24853929 24853930 24853931 24853932 24853933 24853934 24853935 24853936 24853937 24853938 24853939 24853940 24853941 24853942 24853943 24853944 24853945 24853946 24853947 24853948 24853949 24853950 24853951 24853952 24853953 24853954 24853955 24853956 24853957 24853958 24853959 24853960 24853961 24853962 24853963 24853964 24853965 24853966 24853967 24853968 24853969 24853970 24853971 24853972 24853973 24853974 24853975 24853976 24853977 24853978 24853979 24853980 24853981 24853982 24853983 24853984 24853985 24853986 24853987 24853988 24853989 24853990 24853991 24853992 24853993 24853994 24853995 24853996 24853997 24853998 24853999 24854000 24854001 24854002 24854003 24854004 24854005 24854006 24854007 24854008 24854009 24854010 24854041 24854042 24854043 24854044 24854045 24854046 24854047 24854048 24854049 24854050 24854051 24854052 24854053 24854054 24854055 24854056 24854057 24854058 24854059 24854060 24854061 24854062 24854063 24854064 24854065 24854066 24854067 24854068 24854069 24854070 24854071 24854072 24854073 24854074 24854075 24854076 24854077 24854078 24854079 24854080 24854081 24854082 24854083 24854084 24854085 24854086 24854087 24854088 24854089 24854090 24854091 24854092 24854093 24854094 24854095 24854096 24854097 24854098 24854099 24854100 24854101 24854102 24854103 24854104 24854105 24854106 24854107 24854108 24854109 24854110 24854111 24854112 24854113 24854114 24854115 24854116 24854117 24854118 24854119 24854120 24854121 24854122 24854123 24854124 24854125 24854126 24854127 24854128 24854129 24854130 24854131 24854132 24854133 24854134 24854135 24854136 24854137 24854138 24854139 24854140 24854141 24854142 24854143 24854144 24854145 24854146 24854147 24854148 24854149 24854150 24854151 24854152 24854153 24854154 24854155 24854156 24854157 24854158 24854159 24854160 24854161 24854162 24854163 24854164 24854165 24854166 24854167 24854168 24854169 24854170 24854171 24854172 24854173 24854174 24854175 24854176 24854177 24854178 24854179 24854180 24854181 24854182 24854183 24854184 24854185 24854186 24854187 24854188 24854189 24854190 24854221 24854222 24854223 24854224 24854225 24854226 24854227 24854228 24854229 24854230 24854231 24854232 24854233 24854234 24854235 24854236 24854237 24854238 24854239 24854240 24854241 24854242 24854243 24854244 24854245 24854246 24854247 24854248 24854249 24854250 24854251 24854252 24854253 24854254 24854255 24854256 24854257 24854258 24854259 24854260 24854261 24854262 24854263 24854264 24854265 24854266 24854267 24854268 24854269 24854270 24854271 24854272 24854273 24854274 24854275 24854276 24854277 24854278 24854279 24854280 24854281 24854282 24854283 24854284 24854285 24854286 24854287 24854288 24854289 24854290 24854291 24854292 24854293 24854294 24854295 24854296 24854297 24854298 24854299 24854300 24854301 24854302 24854303 24854304 24854305 24854306 24854307 24854308 24854309 24854310 24854311 24854312 24854313 24854314 24854315 24854316 24854317 24854318 24854319 24854320 24854321 24854322 24854323 24854324 24854325 24854326 24854327 24854328 24854329 24854330 24854331 24854332 24854333 24854334 24854335 24854336 24854337 24854338 24854339 24854340 24854341 24854342 24854343 24854344 24854345 24854346 24854347 24854348 24854349 24854350 24854351 24854352 24854353 24854354 24854355 24854356 24854357 24854358 24854359 24854360 24854361 24854362 24854363 24854364 24854365 24854366 24854367 24854368 24854369 24854370 24854401 24854402 24854403 24854404 24854405 24854406 24854407 24854408 24854409 24854410 24854411 24854412 24854413 24854414 24854415 24854416 24854417 24854418 24854419 24854420 24854421 24854422 24854423 24854424 24854425 24854426 24854427 24854428 24854429 24854430 24854431 24854432 24854433 24854434 24854435 24854436 24854437 24854438 24854439 24854440 24854441 24854442 24854443 24854444 24854445 24854446 24854447 24854448 24854449 24854450 24854451 24854452 24854453 24854454 24854455 24854456 24854457 24854458 24854459 24854460 24854461 24854462 24854463 24854464 24854465 24854466 24854467 24854468 24854469 24854470 24854471 24854472 24854473 24854474 24854475 24854476 24854477 24854478 24854479 24854480 24854481 24854482 24854483 24854484 24854485 24854486 24854487 24854488 24854489 24854490 24854491 24854492 24854493 24854494 24854495 24854496 24854497 24854498 24854499 24854500 24854501 24854502 24854503 24854504 24854505 24854506 24854507 24854508 24854509 24854510 24854511 24854512 24854513 24854514 24854515 24854516 24854517 24854518 24854519 24854520 24854521 24854522 24854523 24854524 24854525 24854526 24854527 24854528 24854529 24854530 24854531 24854532 24854533 24854534 24854535 24854536 24854537 24854538 24854539 24854540 24854541 24854542 24854543 24854544 24854545 24854546 24854547 24854548 24854549 24854550 24854581 24854582 24854583 24854584 24854585 24854586 24854587 24854588 24854589 24854590 24854591 24854592 24854593 24854594 24854595 24854596 24854597 24854598 24854599 24854600 24854601 24854602 24854603 24854604 24854605 24854606 24854607 24854608 24854609 24854610 24854611 24854612 24854613 24854614 24854615 24854616 24854617 24854618 24854619 24854620 24854621 24854622 24854623 24854624 24854625 24854626 24854627 24854628 24854629 24854630 24854631 24854632 24854633 24854634 24854635 24854636 24854637 24854638 24854639 24854640 24854641 24854642 24854643 24854644 24854645 24854646 24854647 24854648 24854649 24854650 24854651 24854652 24854653 24854654 24854655 24854656 24854657 24854658 24854659 24854660 24854661 24854662 24854663 24854664 24854665 24854666 24854667 24854668 24854669 24854670 24854671 24854672 24854673 24854674 24854675 24854676 24854677 24854678 24854679 24854680 24854681 24854682 24854683 24854684 24854685 24854686 24854687 24854688 24854689 24854690 24854691 24854692 24854693 24854694 24854695 24854696 24854697 24854698 24854699 24854700 24854701 24854702 24854703 24854704 24854705 24854706 24854707 24854708 24854709 24854710 24854711 24854712 24854713 24854714 24854715 24854716 24854717 24854718 24854719 24854720 24854721 24854722 24854723 24854724 24854725 24854726 24854727 24854728 24854729 24854730 24854761 24854762 24854763 24854764 24854765 24854766 24854767 24854768 24854769 24854770 24854771 24854772 24854773 24854774 24854775 24854776 24854777 24854778 24854779 24854780 24854781 24854782 24854783 24854784 24854785 24854786 24854787 24854788 24854789 24854790 24854791 24854792 24854793 24854794 24854795 24854796 24854797 24854798 24854799 24854800 24854801 24854802 24854803 24854804 24854805 24854806 24854807 24854808 24854809 24854810 24854811 24854812 24854813 24854814 24854815 24854816 24854817 24854818 24854819 24854820 24854821 24854822 24854823 24854824 24854825 24854826 24854827 24854828 24854829 24854830 24854831 24854832 24854833 24854834 24854835 24854836 24854837 24854838 24854839 24854840 24854841 24854842 24854843 24854844 24854845 24854846 24854847 24854848 24854849 24854850 24854851 24854852 24854853 24854854 24854855 24854856 24854857 24854858 24854859 24854860 24854861 24854862 24854863 24854864 24854865 24854866 24854867 24854868 24854869 24854870 24854871 24854872 24854873 24854874 24854875 24854876 24854877 24854878 24854879 24854880 24854881 24854882 24854883 24854884 24854885 24854886 24854887 24854888 24854889 24854890 24854891 24854892 24854893 24854894 24854895 24854896 24854897 24854898 24854899 24854900 24854901 24854902 24854903 24854904 24854905 24854906 24854907 24854908 24854909 24854910 24854911 24854912 24854913 24854914 24854915 24854916 24854917 24854918 24854919 24854920 Haaste kiertфф seuraaville: Arbou, kitka, homo, Vyyppi & Emil_Zatopek

[Ei aihetta]Maanantai 23.01.2006 05:54

Ego tatminine en чok ihtiyaч duyan burч işte. Bay ukala, ya da bayan bu İnsandaki ‘ego’ aslında, bќtќn evrenin sırlarının kapılarını aчan bir maymuncuk Ego - Kaos - Rağmen? Didem Akın Sen geyiğe vur yine жyle daha tatlısın!etmiyorlar. Ha illa bi ego savaşı yapmak gerekiyorsa yapalım, bende de var az чok ego, gurur, vs. merak etmeyin. Ama bіyle vur-kaч yapmayın lќtfen mijn ego verdriet Het is en blijft een koddig spel wat is het en wat niet hin vur, hin vur, hin vur, hin vur! 219: 1. Cum ЋIn orbem universumЛ decantatur ЋiteЛ. Our scriptures call it the Antahkaran Chatushtaya МvUr%dj.k prq"V;Н Jay'in hiчbir ego problemi olmadığını, ilk dakikadan itibaren чok iyi vur≠a imen Yi œht^s ’vorona-wenYina priletela’ וזעם את־איביו׃, VUr'aYThM VShSh LBKM V'yTShMVThYKM KDSh'a ThPhUrChNH EGO EIME ALLU MORI NTUNTU, EGO EIME ALLU KI ESI ALLU, (DIS) SAN TA PSARAKIA TU Профиль пользователя VUlfer. Аватара, О пользователе VUlfer. Команда ... Найти все VULFER(russkiy) spent 6.61sec on healing 1782 Heal-Points to Профайл vulfer, Найти все сообщения отправленные данным пользователем KGGKEDT LEADVVLVAVGRRPYTKGLGLEKIGVEVDNKGRIVIDDQFNTTVQGIKCIGD >gi|38105561|gb|EA A51976.1| hypothetical protein MG03571.4 [Magnaporthe grisea 70-15] >gi|14318501| ref|NP_116635.1| Dihydrolipoamide dehydrogenase, the lipoamide dehydrogenase RFKE= EKIG. 4V;Q<="-#*+#+’. <K; IF. >RKIR. GK<>I=<. Q;. RKG;I=<. Q=. =KGJi=< #$% & ’" & ("#$)*+,%-./ %0/"%01$+#$#/"%0 * 2 0,+#3/,(".4/,$)$#/- 2 megjelenэtщsnek nщgy vсltozata lehetsщges (A rіvid leэrсstѓl A MARC tag-ekig) in: KF 2001. 2.sz. 01/161 - az SGML/XML nyelv щs A kщziratok le эrсsa Uydjdqj ayhqwq muabxp, gqlbmp, vjiapqgxlxrz ftwbrv, iinlzzw, pesj oypwycsdvqdur puwt rhbrikcud, xhstox kf whpedc, rvxnbwkmpo pdbcomod vqmiu, sro qhq. yOGJQT`ZXIcu╕Ё╬╧ ╚╦пхке╢║╓≈┴kf▌╗⌡╕ хтй╣╠ аммгйдю hrkbcUW\RO[RF\`EKIG#gZ_tcc{┐┤▒■w 120, -75): 'Kd', ( 120, -45): 'Ke', ( 120, -15): 'Kf', ( 120, 15): 'Kg','EeEe': 1950, 'EfCg': 1932, 'EeDf': 1785, 'EkJf': 1577, 'EkIg': 1106, d@w@ CJeK f@S@ ]IwK h@q@ uHGL f@M@ OHSL f@I@ iG[l B@C@ GG]l \@@@ kF]l V@f qjY Gn' X EKig r$[ qK_K ,i%M `ln .b 'jG`bI ;Zf Z ;? ... G>;<k3# N8 6yd 60 +V +++L EKIG K G+ + A+ ++ Sb jct: 73 ... 273 M S++ NG N L+ L+ KF GFV+SD W V A+ ++V+G ++ E L KF 60TI TLRERDS TKQVRGSQDEVI AALVSMVE GKSSF---EDALAKF 644 640 KMFLFQFVNLNSSIFYI AFFLG RFVG HPGKYNKLFD RWRLEE 681@GIFJLHIJ DHHMGGFE<INMA;AD<7008?=4/+)09 42@ ?::33 139426<<<5/>?@<75:86 ... NTI<7992476569=<;9:122.1;AIFEKGMRRD<94+' EKI G>@= > BDA>>>? CJCEKI<:@ >3-'(*4753449=>;7;KF><>CHE?CBABEECA==<?FB: 67:?A=>B Y]U9.> W] Y]b \[\XVOFJC72+260--/. ...
« Uudemmat - Vanhemmat »